Conserved Protein Domain Family
PHA00738

?
PHA00738: PHA00738 
putative HTH transcription regulator
Statistics
?
PSSM-Id: 177305
View PSSM: PHA00738
Aligned: 8 rows
Threshold Bit Score: 99.6549
Threshold Setting Gi: 270281815
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
42494962    1 MTYNANEIRAKILRKKILELIAENYVLSASLISHTLLLSYATVLRHLRILNEHGYIELYKEGRTLYAKIKENSKQIQILN 80 
38639830    2 SDYNSNSVRAKILRRKILELIAENYILSASLISHTLLLSYTTVLRHLKILNEQGYIELYKQGRILYAKIRENSKQIQILY 81 
42495084   13 SDYNANSIRAKILRRKILELIVENYVLSASLISHTLLLSYATVLRHLRILNEQGYIELYKQGRTLYAKIRENAKEIQILN 92 
160688420   2 SDYNANEIRAKIIRKKILQLVAENYILSASLISHTLLLSYATVLRHLRILNEEGYVELYKEGRTLYAKIRENSKQIQILN 81 
198449231   1 MTYNANEIRAKIVRRKILQLVAENYILSASLISHTLLLSYATVLRHLRILNEEGLIELYKEGRTLYAKIRENSKEIQILN 80 
270281848   2 TEYNSNSVRAKILRRKILELIAENYILSASLISHTLLLSYTTVLRHLKILNEQGYIELYKQGRILYAKIRENSKQIQILY 81 
270281815   2 ARAYANILKGELTRRKILKLLAENYALSVAFISHSVLLSYTATMKHLKILKEQDLIEMWEEQGRIYVALKEKAKELK--- 78 
270281781   1 MKAYANELKGKQTRKKIVKLLAENYALSVAFISHSILLSYTATMKHLKILKEQNLIEMWEEQGRIYVALKEKAHELR--- 77 
42494962   81 SELEGFKKLNEKTLVTENEgsrGIVSTKETK 111
38639830   82 TELEGFKKTSENLDLNKDG---HQTNAKPQI 109
42495084   93 SELEGFKKLSDKPLLTKDG---SLVKVKRND 120
160688420  82 SESTQFKNSLNNTILTK-----NVVKTKDNT 107
198449231  81 SELRGFKKLSEKPDLTKNG---GLVKTKDNT 108
270281848  82 TELEGFKKTSENLDLNKDG---HQTNAKPQI 109
270281815  79 ------KELSEEKDKN--------------- 88 
270281781  78 ------KELND-------------------- 82 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap