Conserved Protein Domain Family
PHA00736

?
PHA00736: PHA00736 
hypothetical protein
Statistics
?
PSSM-Id: 177304
View PSSM: PHA00736
Aligned: 7 rows
Threshold Bit Score: 82.53
Threshold Setting Gi: 160688418
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
160688418  1 MTDAISLALSTGLGPVIAIIIILIFMGLTYKMAGRIPAIITGIASTFTLMVMDFLPLFWGITVIFGLIAGLVLGggNNGD 80 
9625542    1 MTDAISLALQTGLGPVVGVIIILAMMGLTYKIAGKIPAIITGIASAFVLMFMDFLPLFWGIAIIFGLIAGMVVT--RDGD 78 
42494960   1 MTDAISLALQTGLGPVIGVVIIISLMGLTYKIAGRIPAIITGIASTFVLIFMDFIPVYWGIGIIFGLIAGMVLGg-KDGY 79 
42495083   1 MTDAISLALQTGLGPVIAVVIIIGMMGLTYKMAGKIPAILVGIASTFALTFMNFLPLFWGIAVILGLIAGLILGg-RDGD 79 
38639828   1 MTDAISLALSTGLGPVVAIIIILVMMGLTYKMAGKIPSILVGIASTFALMFLDFLPLFWAITVIFALIAGLVLGg-RDGD 79 
198449229  1 MTDAISLALQTGLGPVIAIIITLAMMGLVYKMAGKIPAILVGIASTFTLTFMNFLPLFWGVTIIFGLIAGLVLGgdRNGD 80 
270281846  1 MTDAISLALSTGLGPVVAIIIILVMMGLTYKMAGKIPALLVGIASTFTLMVMDFLPIFWGITVIFGLMAGLVLGg-RDGD 79 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap