Conserved Protein Domain Family
PHA00735

?
PHA00735: PHA00735 
hypothetical protein
Statistics
?
PSSM-Id: 177303
View PSSM: PHA00735
Aligned: 7 rows
Threshold Bit Score: 1038.31
Threshold Setting Gi: 9625541
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
270281845   1 MKWS-LSLLLLTLLILPISflpANAIVTGPHPYFDGGGGFTGPFFTYSKTIQVGSSIYSSKYNGSTLSTAPWLNPTYISV 79 
38639827    1 MKWSlLSLLLLTLLILPIS---TNAVITGPHPYFDGGGGFAGPFFTYSKTIQVGSSTFSSKYNGSTLSTAPWLNPTYISV 77 
42494959    1 MKWGlSLLLLLTLLLSPIL---TNGVITGPHPYLDGGGGFTGPFFKYSNTIQVGSSTFSSKYNGSTLSTAPWLNPTYVSI 77 
42495082    1 MKWG----LLFSIFFISLFslnSLALLIG------GGGPNNSGAGVYTQTITVNGGTVSTKVNGSTLSTAPWLNPTYVSI 70 
9625541     1 MKWG----LLFLIMFISIFslnSLALLIG------GGGPNNNGAGVYTQTITVNGGTVRTTLNGSTLSTAPWLNPSYVSV 70 
160688417   1 MKWG-LSLLLLTLLLLPII---ANGIVTGPHPYFDGGGGFTGPFFPYSKTIQVGSSTFSSKYNGSTLSTAPWLNPTYISV 76 
198449228   1 MKWG-LSLLLLTLLLLPII---ANGIVTGPHPYFDGGGGFTGPFFSYSKTIQVGSSTFSSKYNGSTLSTAPWLNPTYISV 76 
270281845  80 YNKYYLQVLPNQQYISNNVSLSLSSSQIALNVTWLLASSSNTGSYGSIAIGYGVNFPAGFTGTYAPASPYASDGIVVYME 159
38639827   78 YNKYYLQVLPNQEYINNNASLSLSSSQIALNVTWLLASSSNSGSYGSIAIGYGVNFPSGFTGSYAPASPYASDGIVVYME 157
42494959   78 YNTYYLQVLPNQQYISNNVSLPLSSSQIALNVTWLLASSGNSGSYGSIAIGYGVNFPSGFTGNYAPAPPYASDGIVVYLE 157
42495082   71 YNTYYLQVLPNQEYITNNVSLSLSSSQIALNVTWLLASSSNTGSYGSIAIGYGVNFPSGFTGSYAPALPYASDGIVVYME 150
9625541    71 YNTYYLQVLPNQEYIDNNVSLSLNTANIALNVTWLLASSSNTGSYGAIAIGYGVNFPAGFVNNYGPSAPYTPDGIVIYLM 150
160688417  77 YNKYYLQVLPNQQYISNNVSLSLSSSQIALNVTWLLASSSNTGSYGSIAIGYGVNFPSGFTGSYAPASPYASDGIVVYME 156
198449228  77 YNKYYLQVLPNQEYINNNVSLSLSSSQIALNVTWLLASSSNTGSYGSIAIGYGVNFPSGFTGSYAPASPYASDGIVVYME 156
270281845 160 KGSFPTYRLFVYFDGVKQLNVSVGSISVGQQIGLGFWYLPASNQLYVYYYNGTLKTFTIYPGQVINNQFYPLSLNTVNSN 239
38639827  158 KGSFPTYRLFVYFDGVKQLNVSVGSISVGQYIGLGFWYLPSSNQLYVYYYNGTLKTFSIIPGQVINNQFYPLSLNTVNSN 237
42494959  158 KGSFPTYRLFAYFDDVKQLNVSVGSISVGQYIGLGFWYLPATNQLYVYYYNGTLKTFSITPGQIINNQFYPLSLNTINSN 237
42495082  151 KGSFPTYRLFVYFDGVKQLNVSVGSISVGQQIGLGFWYLPASNQLYVYYYNGTLKTFSITPG---------LSLNTINSN 221
9625541   151 KGGMPTYRLFVYFNGVEQLNVSVGSISVGQKIGLGFFYL--QNTLYVYYYNGTLKTWSLTPG----------TLITINSN 218
160688417 157 KGSFPTYRLFVYFDGVKQLNVSVGSISVGQQIGLGFWYLPASNQLYVYYYNGTLKTFSIIPGQVINNQFYPLSLNTVNSN 236
198449228 157 KGSFPTYRLFVYFDGVKQLNVSVGSISVGQQIGLGFWYLPASNQLYVYYYNGTLKTFSIIPGQVINNQFYPLSLNTVNSN 236
270281845 240 YVIDAQNVGPGYGYGQWVVITYSIFQYKTYTATLSYTSVV-GNGIQMLAGFTGANNPLNISTN-ATSWSVVGIMKIQNFS 317
38639827  238 YVIDAQNVGPGYGYGQWVVITYSIFQSKTYTATLSYTSVV-GNGLQMLAGFTGANNPLNISTN-ATSWSVVGIMKIQNFS 315
42494959  238 YVIDAQNVGPGYGYGQWVLISYSIFQTKTYSATLSYTSVIlGNGIQALAGFTGAYNPLNVSTN-VTSWSVVGIVKVVNYS 316
42495082  222 YVIDAQNVGPGYGYGQWVIVSYQYFTQVTAQLTVSYFALA-YNIYHFLMVYAGAGNPVNIS---GALYSISGIVSQKNFT 297
9625541   219 YVIDAQNIGPGYGYGQWVIVNYQYAMPVTAQLTVSYFALG-YNVYHFLMAYAGAGNPVNITANnGASYSITGIVAEKNFT 297
160688417 237 YVIDAQNVGPGYGYGQWVVITYSIFQSKTYTATLSYTSVIlGNGVQALASFVGANNPLNVSTN-ATSWSVVSIVKVVNYS 315
198449228 237 YVIDAQNVGPGYGYGQWVVITYSIFQSKTYTATLSYTSVIlGNGVQALAGFVGANNPLNVSTN-ATSWSVVSIVKVVNYS 315
270281845 318 ATGTLYSLSGSISYTSAPKGIYLLLN-VYPSGNINGWYLNITIEFQFVTASSTVYMNITIPVFVAGFAVLVQVNLPSSSY 396
38639827  316 VTGTLYPLSGSVSYVSAPKGIYLLLN-VYPAVNVNTWYLNVTIEFQFVTQQQTVLENVTIPVFVAGFAVLVQVNLPQPSY 394
42494959  317 VSNSQYSLIGSVSYLTSTNTVYFILNsIYPTYSVNTWYLNVTLEFQFVTPSSTVYKNITIPIFDGGFAVLVQVSLPQSSY 396
42495082  298 ITGIQQGLAYTFNILGKSNGLYLLYT-GPIEGNPPTWYVNVTIGLQIVTSQVTINYNLTIPVIVEGYALYPSVNLPSGTY 376
9625541   298 ITGIQQGLAYAFSLLGKPNGLYLLYM-GPIEGSPPTWYVNVTVGLQIVTPQKTINYNLTIPVIVEGYALYPSVNVPSGTY 376
160688417 316 VSNSQYPISGSVSYTATTKGIYFILN-VYPAPNVNTWYLNVTVEFQFVTASSTVYMNITIPVFVGGFAVQVQVNLPQSSY 394
198449228 316 VSNSQYPVSGSVSYTATTKGIYLLTN-VYPASNVNTWYLNVTVEFQFVTASSTVYMNITIPVFVARFAVLVQVNLPQSSY 394
270281845 397 LAGQTISVTNSTTIMYPPNAGYSLVQPPKALINIQGLTNGFVPLPYVITANTVIPTTYDYVVNIQLGQFSLGSATGTITI 476
38639827  395 LTGQTISVTNSTTIEYPSNAGYSLAVQPQTLINIQGLTNGFVPLPYTITANAVNPTTYYYTINIQLGQFSLGSATGTITI 474
42494959  397 LSGQTISVSNSTTIEYPSNAGYSLALKPVVEINIQGLTNGFVPLPYTVTANVNAQTTYYYVINIQFGQFSLGGQTGTITI 476
42495082  377 LSGQTISFALTNIIGYPSNLGYYTAVSERANVSINGVTY---PIPYSFTPIVQVPTTYYYTVIVTEGPISMIDYSGSFTV 453
9625541   377 LSGQTISFTLSSFLGYPSGLGYYTAVNLIANVTINGVSH---AIPYSFTPIVQTPITYYYTVIVDEGQFALIDYQGSFTV 453
160688417 395 LTGQTISVTNSTTIMYPPNAGYSLAVQPQTVINIEGLTNGFVALPYIITANAVVPTTYYYIINIQLGQFSLGSATGTITI 474
198449228 395 LAGQTISVTNTTTIMYPPNAGYSLVQPPKVLINIQGLTNGFVALPYIITANAVVPTTYYYIINIQLGQFSLGSATGTITI 474
270281845 477 YPVSPLPVIFVSQYPHTAQVGTKVTITFQFSYNTPVSNVSSSVFTQITTTFMWAYASILTSSSVIQFKAYWLNASDGFII 556
38639827  475 YPVSPLPVIFVSQYPHSVVAGTKVTITFQFSYNTPVSNVSMTAFTQTTSTFAWAYASIISSSSVIQFKSYWLSAGDGILL 554
42494959  477 YPVSQLPVIFVSQYPTSVTSGTKVTITFQFTLNTPVSNVTMSAFTYSTTTFTWTYASLLSSSSLVEFQGYWLSANDGIII 556
42495082  454 LPAQSYPVLFVTSYPKIGILGQTITITFQFTYNSPVANVTQSAFTQTSTILAFAYAKMVTTNAIVQFKAYWLSANDGLVI 533
9625541   454 LPAQSQPVIFITSYPRIGLLGQTITVTFQFTYNSPVANVTQSAFTQSSNILAFAYAKMVTTNAIVQFKAYWLSANDGLVI 533
160688417 475 YPVSPLPVVFIGQYPHTAQVGTKVTITFQFSYNTPVANVTMSAFTQTTSTFAWAYASIITSSSVMQFKGYWLSAGDGILL 554
198449228 475 YPVSPLPVIFVSQYPHSVVAGTKVTITFQFSYNTPVANVSSSVFTQTTSTFMWAYASIITSSSVIQFKSYWLSAGDGILL 554
270281845 557 ITQS-QNYLIPFN--FVGLTWYNNSINTIQINVINNGLQFVIN--GGTLNIANSSKVIGLGFYYGAGKLVLNWIFVSGIV 631
38639827  555 ITQN-QNYLIPFN--FTGLTWYNNSINTVQINVVNNALQLTIN--GGTLNIANSSKVIGLGFYYGAGKLALNWVFVSGII 629
42494959  557 ITQS-QNYLIPFN--YVGLTFYNNSVNTIQINIVNNALQLNVN--NNVLNLANSSKVIGIGFYYGAGKLVLNWFFVSGIV 631
42495082  534 ITQSgNNYLIPFNssLTGLKFVNNSVNTLTFQIVTGNYVQISSsaGGVLTISNTSPIIGLGFYYGAGKLVLNWFFVSGIV 613
9625541   534 ITQT-NNYLIPFNssITGLNFANNSVNTLTFQIVTGNYVQITSsaGGVLTLSNTSPIIGIGFYYGSGVLHLNWFFVSGII 612
160688417 555 ITQS-SNYLIPFN--FTGLTWYNNSINTIQINVINNALQLTIN--GGTLNIGNSSKVIGLGFYYGAGKLVLNWFFVSGII 629
198449228 555 ITQS-SNYLIPFN--FTGISFYNNSVNTVQIGIINNGLQLTIN--GYTLNIANTSPVIGLGFYYGAGKLTLNWFFVSGII 629
270281845 632 LQSATANQAYVISVGTNPSTLTQYTTGYTNSSGFGQVTITLTNTPYELINIYWAGVNKNVLLNITVTQPTT-STTTTVNI 710
38639827  630 LQSATANQAYVISVGTNPSTLTQYTTGYTNSSGFGQVTITLTDTPYELINIYWAGVNKNVLLNITVTQPTT-STTTTVNI 708
42494959  632 LQSATANQAYTILTGTSLNTLTQYTNGYTNASGFGQVTVTLTYTPYELVEIYWGGLQKYTILNISVTQPTT-TTTTTVNT 710
42495082  614 LQSATANQAYIILTGTNPNTLSQYVTGYTNASGFGSVTLKLSYTPYELIDVYWYGVT-YQILNISVSNTTTvSSTTTVNT 692
9625541   613 LQSATANQAYVILTGTNPNTLSQYTTGYTNASGFGTVTLKLSYTPYELVDVDWYGVT-YALLNISVSNTTTvSSTTTVNT 691
160688417 630 LQSATANQAYVVLTGTNPSTLSQYVSGYTNSSGYGQVTVTLTDTPYELVDIDWAGVT-YVILNISVSQPVT-TTTTTVNV 707
198449228 630 LQSATANQAYVISIGTNPSTLTQYTTGHTNSSGFGQVTITLTDTPYQLINIYWAGVNKNVLLNITVTQPTT-TTTSTVNV 708
270281845 711 STINYNYTQPFTNNIQPNSSLYNFSQYQPWSTLIGITVTALVTLLGWKFGGKAGVSGGAIMGLIMTAYLGLVPWYIFYIF 790
38639827  709 STINYNYTQPFSNNIQPNSSIYNFSAYQPWSTIIGIAVTVVVALLGWKFGGKAGVSGAVVMGLIMSAYLGLIPWYIFYIF 788
42494959  711 STLNYNYTNPFSNNISPTSSLYNFSNAQPWAMLIGIAVTVIVTLLGWKFGGKGGASGGVVMGLIAVSYLGLVPWYIFYIF 790
42495082  693 TTLNYNYTNPFSNNISPNSSLYNFSQYQPWAEIIGIVVTVLIALLGWKFGGSAGASGGAVMGLIATAYLGLIPWYIFYIF 772
9625541   692 TTLNYNYTKPFSNNIAPNSQLYDFSAYQPWAEIIGIVVVVVIALLGWKFGGSAGASGGAVMGLIAVSYLGLLPWYLFYIF 771
160688417 708 STLNYNYTQPFTQSISPNSSLYNFSAYQPWATLIGIVITVVVALLGWKFGGKAGASGAVVMGLIMTAYLGLMSWYIFYIF 787
198449228 709 STLNYNYTQPFTQSIQPNSSLYNFSNEQPWATIIGVVVTSLVALLGWKFGGKAGASGAVVMGLIMTAYLGLMPWYLFYIF 788
270281845 791 VFGVAMLLAKVMIDKFMGSDE 811
38639827  789 IFGIAMLLAKVMIDKFMGSDE 809
42494959  791 IFGIALLLAKIFVDRFMGSEE 811
42495082  773 IFGIALLLAKTMVDRFMGREE 793
9625541   772 VFGIALLLAKVFVDRFMGREE 792
160688417 788 IFGIALLLAKIFVDKFMGSEE 808
198449228 789 IFGIAMLLAKVMIDKFMGSDE 809
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap