Conserved Protein Domain Family
PHA00732

?
PHA00732: PHA00732 
hypothetical protein
Statistics
?
PSSM-Id: 177300
View PSSM: PHA00732
Aligned: 8 rows
Threshold Bit Score: 132.589
Threshold Setting Gi: 42494950
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
42495075   1 MFRCPICGFTTIKLFALKQHTRRNHVLNKCPVCNNSYIRLNQHFYGKYDIDHLVYCYLFTTYKLPPHVRLAIKRKLEVG 79 
38639820   4 MFKCPICGFTSVTLFAVKQHARKNHILTKCPVCNTEYRHLNQHFYFQSDMEHLIYCYLFGSYKLPFHVRLAIKRKLQVE 82 
42494950   1 MYKCPLCQFKTTRLFALKQHTRKNHVLTKCPVCKNSYIRLNQHLYTKYDIEHLMYCYLFSTYKIPKNVMLAIKRKLEVE 79 
9625535    1 MFRCPICGFKTLRLFALKQHTRREHVLVKCPICGFTGKHLSQHFYSRYDIDHLIYCYLFSSFRLPKNVRLAIKRKLEVE 79 
160688443  2 LFRCPVCGFTSVTLFAVKQHARKNHTLTKCPVCQKSYRRLNQHFYSQTDIEHLTYCYLYSTYKLPYHVRLTIKNKLRVE 80 
198449254  2 LFRCPVCGFTSVTLFAVKQHARKNHTLTKCPVCQKSYRRLNQHFYSQTDIEHLTYCYLYSTYKLPYHVRLTIKNKLRVE 80 
270281838  4 MFKCPICGFITIRLFALKQHVRRNHTLDKCPVCNQKYTRLNQHFYYKSDIDHLLYCYLFSTYKLPHHTRLAIKKHLEVE 82 
270281807  4 MFKCPMCDFVSVTLFAVKQHARREHTLTKCPVCQKQYRHLNQHFYFQYDMEHLVFAFLFSKYKLPYHVRLTIKKKLEVE 82 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap