Conserved Protein Domain Family
PHA00729

?
PHA00729: PHA00729 
NTP-binding motif containing protein
Statistics
?
PSSM-Id: 177297
View PSSM: PHA00729
Aligned: 9 rows
Threshold Bit Score: 329.827
Threshold Setting Gi: 9625520
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
42494933    1 MIWMPKKkvkhintgqlgqmIIKEMQENGFQSIIIFGKQGAGKTTYALKVGARILMYLYPDLSEHDAWWQAYnlMVFSLD 80 
42495063    6 LLWLAKK-------------IVEAYNTMGFVSAVIFGPQGTGKTTYAFKVARDVEFALRGLQTKDEAWKYVK--YFFELP 70 
9625520    13 WLWLGTK-------------IINAHKTNGFESAIIFGKQGTGKTTYALKVAKEVYQRLGH--EPDKAWELALdsLFFELK 77 
38639804    8 MLWLAQK-------------IVSAYNNVGFVSAVIFGKQGSGKTTYAFKVSRDVFWKLNNLSTKDDAWQYVQnsYFFELP 74 
160688428   8 MLWLAQK-------------IVSAYNNVGFVSAVIFGKQGSGKTTYAFKVARDVFWKLNNLGNKDDAWQSVRdaYFFELP 74 
198449239   8 MLWLAQK-------------IVSAYNNVGFVSAVIFGKQGSGKTTYAFKVSRDVFWKLNNLSTKDDAWQYVQnsYFFELP 74 
270281753   7 VLWLSKK-------------IVSAYHNIGFVSAVVFGKQGSGKTTYALKVARDVFWKLNNLENKDDAWDYVRnaYFFELP 73 
270281792   9 MLWLAQK-------------IVSAYNNVGFVSAVIFGKQGSGKTTYAFKVARDVFWKLNNLSTKDDAWQYVQnsYFFELP 75 
270281825  30 MLWLAQK-------------IVSAYNNVGFVSAVIFGKQGSGKTTYAFKVARDVFWKLNNLSTKDDAWQYVQnsYFFELP 96 
42494933   81 EAIEKLMSVVDMhekgniNYRLPFLIIDDASIDLIKYAWHEPQNIEFAKLNNLARTWSTALIFTTPWIDDLQKFLREKAW 160
42495063   71 DALEYIQEITER------DERIPYIIFDDASIWLSKYYWYMDYMKAFYSYYALIRTRVSAVIFTTPAPDDIAYFLREKGW 144
9625520    78 DALRIMKIFRQN------DRTIPIIIFDDAGIWLQKYLWYKEEMIKFYRIYNIIRNIVSGVIFTTPSPNDIAFYVREKGW 151
38639804   75 DALSKIQDAIDN------DYRIPLLIFDDAGIWLSKYVWYEDYMKTFYKIYALIRTRVSAVIFTTPSPEDLAFYLREKGW 148
160688428  75 DALSKIQDAIDN------DYRIPLLIFDDAGIWLSKYVWYEDYMKTFYKIYALIRTRVSAVIFTTPSPEDLAFYLREKGW 148
198449239  75 DALSKIQDAIDN------DYRIPLLIFDDAGIWLSKYVWYEDYMKTFYKIYALIRTRVSAVIFTTPSPEDLAFYLREKGW 148
270281753  74 NALDKIQDAIDN------DYRIPLIIFDDAGIWMSKYVWYEDYMKVFYKIYALIRTRVSAVIFTTPSPEDIAFYLREKGW 147
270281792  76 DALSKIQDAIDN------DYRIPLIIFDDAGIWLSKYVWYEDYMKTFYKIYALIRTRVSAVIFTTPSPEDLAFYLREKGW 149
270281825  97 DALNKIQDAIDN------DYRIPLIIFDDAGIWLSKYVWYEDYMKTFYKIYALIRTRVSAVIFTTPSPEDLAFYLREKGW 170
42494933  161 IVVQVQKYGKAEGKYPQSIAWIYKRVIKliNGEFKGVYEEKYYDIFRREIPNDLYEEYIKRRDGVMKKIANEVLGKLRER 240
42495063  145 YQIKIIWNNKKKKIAKAMLYEKEFARNI--RGDFTTKSNYTALDYFKVELPNDFYAEYLKKRKEKELDLLAQIKVSLNRI 222
9625520   152 KLIMITRNGRQPDGTPKAVAKIAVNKITiiKGKITNKMKWRTVDDYTVKLPDWVYKEYVERRKVYEEKLLEELDEVLDSD 231
38639804  149 YQIRVTMVNRKTMTARATLYSKDFGRNS--KGEIVTQVKKKALDLFKVQIPDIIYKEYMQRRRETERKLLQELRQILSTL 226
160688428 149 YQIRVTMVNRKTMTARATLYSKDFGRNS--KGEIVTQVKKKALDLFKVQIPNNIYMEYMQRRRETERKLLQELRQILSTL 226
198449239 149 YQIRVTMVNRKTMTARATLYSKDFGRNS--KGEIVTQVKKKALDLFKVQIPNNIYMEYMQRRRETERKLLQELRQILSTL 226
270281753 148 YQIRVTMVNRNKMIARATLYAKDFGRNT--SGEIVTQVKTKALDFFKVQIPDNIYKEYMQRRKETERKLLEELRKTLSTL 225
270281792 150 YQIRVTMVNRKTMTARATLYSKDFGRNS--KGEIVTQVKKKALDLFKVQIPDNIYKEYMQRRRETERKLLQELRQILSTL 227
270281825 171 YQIRVTMVNRKTMTARATLYSKDFGRNS--KGEIVTQVKKKALDLFKVQIPDIIYKEYMQRRRETERKLLQELRQILSTL 248
42494933  241 ALKVPSA 247
42495063  223 KGKNNEN 229
9625520   232 NKTENPS 238
38639804  227 NVNNSVN 233
160688428 227 NVNNSVN 233
198449239 227 NVNNSVN 233
270281753 226 NEKKAVN 232
270281792 228 NTNNVVN 234
270281825 249 NVNNSVN 255
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap