Conserved Protein Domain Family
PHA00728

?
PHA00728: PHA00728 
hypothetical protein
Statistics
?
PSSM-Id: 177296
View PSSM: PHA00728
Aligned: 8 rows
Threshold Bit Score: 246.38
Threshold Setting Gi: 42494932
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
270281752   1 MAKkngLTEVEQLRKENDELKKKLAELEALMNNETd-EDEKEDLQEIENPYTVTNRAISELVDPKDTMFYLSGNQVSLIL 79 
42494932    1 MAK---KTEVEQLQKENNELKKKLAEIESLLNNNKelDSEEEEIQEIENPYTVTNRAITELVEPKDTMFYLSGSQISLIL 77 
38639803    1 MAKkngVTELEQLRRENEELKKK---LEAIANNES--AEEDKELKEIENPYTVTNRAITELVEPRDTMFYLSGNQISLIL 75 
42495062    1 MAKkngLTEVEQLKKENEELKSKLAKLEALINNE---TEDEVKPPEIENPYTVTNRTISELVSPKDTMFYLSGNQISLIL 77 
160688427   1 MAR---ATELEQLKKENEELKKKIAKLEALMNNES--AEEDEELQEIENPYTVTNRAISELVEPKDTMFYLSGNQISLIL 75 
198449238   1 MAKkngVTELEQLRRENEELKKKLQKLEAIANNES--AEEDKELKEIENPYTVTNRAITELVEPRDTMFYLSGNQISLIL 78 
270281822   1 MAR---ATELEQLKKENEELKKKLQELGAIINN----AEEDEKLQEIENPYTVTNRAISELVEPRDTMFYLSGSQISLIL 73 
270281791   1 ------MTEVEQLKKENDELKKKLAELEALMNNQ---EEDEEELQEIENPYTVTNRSISELVEPKDTMFYLSGSQISLIL 71 
270281752  80 TAYEFARLPSYFGEEPITELAEYAHKLKHYLVSKGGRGRRDILRVLRVSSGDARENINKSVFKQLLEGGkDSDLKE 155
42494932   78 TAFEFARLPSYFGEEPVVELAQFADKLKHYLVSKGGRGRRDVLRVLRVSSGQTRENVNKSLFRKILEGG-DMDAKE 152
38639803   76 TAFEFSRLPAYFGEEPVTELAEFAVRLKHYLVSKGGKGRRDILRVLRVSSGQVRENVNKSLFKQLLQGGrDSDVTE 151
42495062   78 TAFEFAKLPAYFGEEPVVELAQFADKLKHYLVSKGGRGRRDILRVLRVSSGQVRENVNKSLFKQLLHGGkDSDLKE 153
160688427  76 TAFEFAKLPNYFGEEPVTELAEFAHKLKHYLVSKGGRGRRDILRVLRVSSGQARENVNKSIFKQLLQGGkDSDVEE 151
198449238  79 TAFEFSRLPAYFGEEPVTELAEFAVRLKHYLVSKGGKGRRDILRVLRVSSGQVRENVNKSLFKQLLQGGrDSDVTE 154
270281822  74 TAFEFSRLPAYFGEEPVTELAEYAVRLKHYLVSKGGKGRRDILRVLRVSSGQVRENVNKSLFKQLLQGGkDSDVEE 149
270281791  72 TAFEFAKLPSYFGEEPVVELAEYAHKLKHYLVSKGGRGRRDILRVLRVSSGQAKENVNKSIFKQLLQGGrDSDVTE 147
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap