Conserved Protein Domain Family
PHA00726

?
PHA00726: PHA00726 
hypothetical protein
Statistics
?
PSSM-Id: 177294
View PSSM: PHA00726
Aligned: 8 rows
Threshold Bit Score: 99.0209
Threshold Setting Gi: 270281750
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
42494930   1 MIYVSENYALDILIFDITMLITALLFRKPKPKPVKSTLDHKTIrrlGYYTVGAGVLTLFLGHLGFYESFWEYLEGLMLDA 80 
42495060   2 VLLVPKTYAEIALGLDSIMLITALLFRKSKPKKERQTLNRKSI---GYYLIGGSALALLVGHYAFYTTYVTYFTGLLIDA 78 
38639835   2 VLLVPKTYAEIVLVFDTIIMTISLLFRKPKPKSVSLTPNPRFI---GWYLVISAITALAVSHFALYQSLIDYFMGLFLNS 78 
160688425  2 VLLVPKTYGEIVLVFDTIIMTISLLFRKPKHRAVKSTLNHRFI---GWYIVISSVVALIASHFVSYASSLNYFTGLFLNS 78 
198449236  1 MILIPPKYTEIVLVFDSTIMTISLLFRKPKHRQERSIPNPRSI---GWYIVISSVVALIVSHFALYPSLVDYYAGLGIDS 77 
270281820  2 VLLVPKTYGEIILGFDLIMLTTVLLFRKPKHRFVKSTPNPKSI---GYYLVISAITALAVSHFVLYQSLIDYFTGLSLNS 78 
270281789  2 VLLVPKIYAVTALGFDTIMLTTALLFRKPKHKKEKQQLDHRFI---GWYLVISSAVALIVSHFVSYASLVDYYMGLGIDG 78 
270281750  1 MLEISKLYFLIGTVIDLISIFFLLLFRKSKPKTKTSNLDHRGIkrlGYYLIISSILVLVISHLVSFHNYISYFMGLSLMG 80 
42494930  81 FLFYIGLRMVIQ 92 
42495060  79 FVFYMGLRCLYV 90 
38639835  79 LIFYVGVKVLVN 90 
160688425 79 LIFYVGVKILV- 89 
198449236 78 LMFYIGLRCLYV 89 
270281820 79 FMFYMGVKTLVN 90 
270281789 79 AIFYMGLRCLYV 90 
270281750 81 LMFLIGMIMVTN 92 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap