Conserved Protein Domain Family
PHA00725

?
PHA00725: PHA00725 
hypothetical protein
Statistics
?
PSSM-Id: 177293
View PSSM: PHA00725
Aligned: 8 rows
Threshold Bit Score: 86.057
Threshold Setting Gi: 42494929
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9625547    1 MRWGRRDDRDTGKILRNRSRNRFNIYHYVSTVKKVKETERELLRLTQTWkaiRLISYNSVGISINRLTSRLIHKLHELLN 80 
38639834   8 MRWMTNGLTSPKNIRRNSPRFRYNYYDYLTSLQKTKAQIRELNTKPEIH---RVVLSHLSYHRLSRKSFCFISIFDRLLH 84 
42494929   8 IRF--------RKLRIGHTYFRYNYAHYCTTIQKAKAQTREINIRPQNHkaiRVLHRRSRGINALLRPFGFLRKFLGIP- 78 
42495059   2 MRWMSNGLVSPKNIRRNSPRFRFNYAHYCFTIQKVKAQERETNIKPQIH---RVLSHRGFGISLTRRALCLLHHLRNLFY 78 
160688424  1 MRWMSNGLTSPKNIRRNSPRFRYNYYDYLTSLQKAKAQSREINIKSQIH---RVVYRHFVSSRLNRKSLCFLCVFSELLH 77 
198449235  1 MRWGVRNDSYSAKIHRNSPRFRFNYYDYLTSLQKAKAQTREINTKPEIH---RMVYRHFVSSRLNRKSFCFISIFSRLLR 77 
270281788  1 MRWMANGLTSPKNIRRNSPRFRYNYVDYCSAVQKAKAQERETTIRSQIH---RVVPRHFVSSRLNRKSLCFLCVFSRLLH 77 
270281824  2 MRWMTNGLVSPKNIRRNNPRFRFNYADYCFAVQKTKAQIREINTKPQIY---RVLSSHLSYHRLSRKSFCFISIFDRLLH 78 
9625547   81 GLIS 84 
38639834  85 GSVP 88 
42494929     ----    
42495059  79 GIID 82 
160688424 78 GSVP 81 
198449235 78 GVGN 81 
270281788 78 GVGN 81 
270281824 79 GSVP 82 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap