Conserved Protein Domain Family
PHA00692

?
PHA00692: PHA00692 
hypothetical protein
Statistics
?
PSSM-Id: 106990
Aligned: 3 rows
Threshold Bit Score: 148.296
Threshold Setting Gi: 41179406
Created: 9-Dec-2010
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
41179406  1 MTVRDNMLRVENARVRVQEHCMCARFHEDRTHYFVEYPPGFRFGGCRVSKGMGAARALDVLLTRMEQHWKDEQL 74 
45569538  1 MTVRDNMLRVENARVRVQEHCMCARFHEDRTHYFVEYPPGFRFGGCRVSKGMGAARALDVLLTRMEQHWKDEQL 74 
45580789  1 MTVRDNMLRVENARVRVQEHCMCARFHEDRTHYFVEYPPGFRFGGCRVSKGMGAARALDVLLTRMEQHWKDEQL 74 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap