Conserved Protein Domain Family
PHA00676

?
PHA00676: PHA00676 
hypothetical protein
Statistics
?
PSSM-Id: 106983
View PSSM: PHA00676
Aligned: 3 rows
Threshold Bit Score: 211.924
Threshold Setting Gi: 45580772
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
41179389  23 MERANWVMVGGSKADGSVTLGIDVPAKYGVTETPVEWDINQANTEADRRCKNWGYSGADMYREGQFPILKTCHAQGVSPC 102
45580772   1 MERANWVMVGGSKADGSVTLGIDVPAKYGVTETPVEWDINQANTEADRRCKNWGYSGADMYREGQFPILKTCHAQGVSPC 80 
45569521   1 MERANWVMVGGSKADGSVTLGIDVPAKYGVTETPVEWDINQANTEADRRCKNWGYSGADMYREGQFPILKTCHAQGVSPC 80 
41179389 103 WSKTYRVQYQCLSLQS 118
45580772  81 WSKTYRVQYQCLSLQS 96 
45569521  81 WSKTYRVQYQCLSLQS 96 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap