Conserved Protein Domain Family
PHA00673

?
PHA00673: PHA00673 
acetyltransferase domain containing protein
Statistics
?
PSSM-Id: 106981
View PSSM: PHA00673
Aligned: 3 rows
Threshold Bit Score: 278.137
Threshold Setting Gi: 45569517
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
45569517   1 METAIVRRVAFAELADAPTFASLCAEYAHESANADLAGRAPDHHAYAGMEAAGVAHFLGVFRGEELVGFACLLVTPVPHF 80 
45580768   1 METAIVRRVAFAELADAPTFASLCAEYAHESANADLAGRAPDHHAYAGMEAAGVAHFLGVFRGEELVGFACLLVTPVPHF 80 
41179385   1 METAIVRRVAFAELADAPTFASLCAEYAHESANADLAGRAPDHHAYAGMEAAGVAHFLGVFRGEELVGFACLLVTPVPHF 80 
45569517  81 KGQLIGTTESIFVAAAHRPGGAGMALLRATEALARDLGATGLYVSGPTEGRLVQLLPAAGYRETNRTFYRGLHA 154
45580768  81 KGQLIGTTESIFVAAAHRPGGAGMALLRATEALARDLGATGLYVSGPTEGRLVQLLPAAGYRETNRTFYRGLHA 154
41179385  81 KGQLIGTTESIFVAAAHRPGGAGMALLRATEALARDLGATGLYVSGPTEGRLVQLLPAAGYRETNRTFYRGLHA 154
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap