Conserved Protein Domain Family
PHA00670

?
PHA00670: PHA00670 
hypothetical protein
Statistics
?
PSSM-Id: 106978
View PSSM: PHA00670
Aligned: 8 rows
Threshold Bit Score: 761.313
Threshold Setting Gi: 48697195
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
48696684   1 MENSKIVKRL----DFLKTDRKNVEQIWDCIRKYIMPMRSDFFSDLRSEGSinwNQNREVFDSTAGDGLETLSSSLHGSL 76 
45569514   5 TERKLLLSRW----GQLRTERESWMSHWKEISDYLLPRAGRFFVQDRNRGE---KRHNNILDNTGTRALRVLAAGMMAGM 77 
48697195   3 NDDAKILQALnadhGRMKEKRQSYEAVWNDVIDYLMPRLDKFGQLPRPDSEkgrERSQKMFDSTAPLALRNFVAAMDSMI 82 
30387383   4 TEKERLLKQL----AQLKNERTSFESHWLDLSDFINPRGSRFLTSDVNRDD---RRNTKIVDPTGSMAQRILSSGMMSGI 76 
45580765   5 TERKLLLSRW----GQLRTERESWMSHWKEISDYLLPRAGRFFVQDRNRGE---KRHNNILDNTGTRALRVLAAGMMAGM 77 
41179382   5 TERKLLLSRW----GQLRTERESWMSHWKEISDYLLPRAGRFFVQDRNRGE---KRHNNILDNTGTRALRVLAAGMMAGM 77 
89152428   4 TTKERLNKQF----AQLESERQSFEPHWRELSDYINPRGSRFLTSEVNRND---RRNTRIIDSTGTMAARTLASGMMSGI 76 
48696640   1 MENSKIVKRL----DFLKTDRKNVEQIWDCIRKYIMPMRSDFFSDLRSEGSinwNQNREVFDSTAGDGLETLSSSLHGSL 76 
48696684  77 TSPATKWFELAFRDKELNSDDECRKWLENATHDVYSALQD--SNFNLEANETYIDLCGYGNAIMVEEEDEDEegSVVFQS 154
45569514  78 TSPARPWFRLTTSIPELDESAAVKAWLANVTRLMLMIFAK--SNTYRALHSMYEELGAFGTASSIVLPDFDA--VVYHHS 153
48697195  83 TPATQLWHRLKTGNDALNEIASVKAYLQGVVRTLFAARYRwqGGFVTQMGATYQSIGLFGPGALMIEHDVGK--GIVYRN 160
30387383  77 TSPARPWFKLATPDPDMMDYGPVKIWLEVVQRRMNEVFNK--SNLYQSLPVMYASLGTFGTGAMAVMEDDQD--VIRTMP 152
45580765  78 TSPARPWFRLTTSIPELDESAAVKAWLANVTRLMLMIFAK--SNTYRALHSMYEELGAFGTASSIVLPDFDA--VVYHHS 153
41179382  78 TSPARPWFRLTTSIPELDESAAVKAWLANVTRLMLMIFAK--SNTYRALHSMYEELGAFGTASSIVLPDFDA--VVYHHS 153
89152428  77 TSPARPWFRLATPDPEMMDYGPVKLWLEAVQNRMNDMFNK--SNLYQSLPQLYGSLGTYSTGAMAVLDDDED--IIRTMP 152
48696640  77 TSPATKWFELAFRDKELNSDDECRKWLENATHDVYSALQD--SNFNLEANETYIDLCGYGNAIMVEEEDEDEegSVVFQS 154
48696684 155 SPIQDSYFEEDSRGQVVNFYRVFRWTPAQIYDRFGDEGTPEAIIKKAKEASNQAALkqEVVMCVFTRYDKKQNRnagtvL 234
45569514 154 LTAGEYAIAADNQGRVNTLYREFQITVAQMVREFGKDKCSTTVQSLFDRGALEQWV--TVIHAIEPRADRDPSK-----R 226
48697195 161 VPMQRLWFAENNSGLIDKTHVQWELTLRQAAQRFGRENLSPSMQSTLEKDPEKSAI---FYHAVEPRADRDPRK-----L 232
30387383 153 FPIGSYYLANSPRGSVDTCIRQFSMTVRQMVQEFGLDNVSTSVKGMWENGTYETWV--EVNHCITPNVNRDSGK-----M 225
45580765 154 LTAGEYAIAADNQGRVNTLYREFQITVAQMVREFGKDKCSTTVQSLFDRGALEQWV--TVIHAIEPRADRDPSK-----R 226
41179382 154 LTAGEYAIAADNQGRVNTLYREFQITVAQMVREFGKDKCSTTVQSLFDRGALEQWV--TVIHAIEPRADRDPSK-----R 226
89152428 153 FPIGSYYLANSPRGSVDTCFRKFSMTVRQLVQEFGLNNVSESVKSMWESGTYEKWI--EVMHSVYPNIDRDTSK-----L 225
48696640 155 SPIQDSYFEEDSRGQVVNFYRVFRWTPAQIYDRFGDEGTPEAIIKKAKEASNQAALkqEVVMCVFTRYDKKQNRnagtvL 234
48696684 235 APTERPFGKKWILKEGA-VQLGEEGGYYEMPAYAIRWRKSAGSQWGFG-PSHLALPDVLTANRYVELVLRSSEKVIDPAI 312
45569514 227 DDRNMAWKSVYFEPGADeTRTLRESGYRSFRALCPRWALVGGDIYGNS-PAMEALGDVRQLQHEQLRKAQAIDYKSNPPL 305
48697195 233 DGRNMQFASYWLDEGRD--RIVQNSGFRTFPFAIGRFYVGTDDVYGGS-PAYDAMPDVRMANDMAKTNIRGAQKLVDPPL 309
30387383 226 DSKNKPYRSVYFESGGDsDKLLRESGFDEFPILAPRWEVNGEDVYASScPGMLALGQVKALQVEQKRKAQLIDKATNPPM 305
45580765 227 DDRNMAWKSVYFEPGADeTRTLRESGYRSFRALCPRWALVGGDIYGNS-PAMEALGDVRQLQHEQLRKAQAIDYKSNPPL 305
41179382 227 DDRNMAWKSVYFEPGADeTRTLRESGYRSFRALCPRWALVGGDIYGNS-PAMEALGDVRQLQHEQLRKAQAIDYKSNPPL 305
89152428 226 DSKNKPFKSVYYEVGGDnDKLLRESGFDEFPIMAPRWEVNGEDVYGSScPGMLALGPVKALQLLQKRKSQLIDKATNPPM 305
48696640 235 APTERPFGKKWILKEGA-VQLGEEGGYYEMPAYAIRWRKSAGSQWGFG-PSHLALPDVLTANRYVELVLRSSEKVIDPAI 312
48696684 313 MVTERGLISDIDLGASGLTVVRDMES----MKPFESRARFDVSSIQLTDLRSAVRRIYYVDQLQM---KDSPAMTATEVQ 385
45569514 306 QLPVSAKNQDISTVPGGLSYVDAAAPnggiRTAFEVNLDLSHLLADIVDVRERIKASFYADLFLMlanGTNPQMTATEVA 385
48697195 310 LANEDGVLDGFDLRSGALNWGGLNDKgeemVKPLLTGKQAQIGIEFAQDTRQTINQWFYVTLFQIl--VDSGDMTATEVL 387
30387383 306 VAPTSLKNQRVSLLPGDVTYLDVISGqdgfKPAYLVNPNTADLLADIQDTRQTINSAYFVDLFMMlqnINTRSMPVEAVI 385
45580765 306 QLPVSAKNQDISTVPGGLSYVDAAAPnggiRTAFEVNLDLSHLLADIVDVRERIKASFYADLFLMlanGTNPQMTATEVA 385
41179382 306 QLPVSAKNQDISTVPGGLSYVDAAAPnggiRTAFEVNLDLSHLLADIVDVRERIKASFYADLFLMlanGTNPQMTATEVA 385
89152428 306 VAPTSLKNQRASLLPGDITYIDQITGqdgfRPAYLVNPSTADLVADIQDTRQIINSAYFVDLFMMlqnINTRSMPVEAVI 385
48696640 313 MVTERGLISDIDLGASGLTVVRDMES----MKPFESRARFDVSSIQLTDLRSAVRRIYYVDQLQM---KDSPAMTATEVQ 385
48696684 386 VRYELMQRLLGPTLGRLENDFLSPMIQRTFNIRFRAGKLGELPSKLLEsgkAAMDIVYTGPLSRAQKIDQAASIERWAGS 465
45569514 386 ERHEEKLLMLGPVLERMHNEILDPLIELTFQRMVEANILPPPPQEMQG---VDLNVEFVSMLAQAQRAIATNSVDRFVGN 462
48697195 388 QRAQEKGVLLAPTLGRTQSELLGPMIAREVDILAEAGQLPDMPQELIDa-gADVDVEYDSPLNKAMRAGEGAAILQWLQQ 466
30387383 386 EMKEEKLLMLGPVLERLNDEALNPLIDRVFSIMARKNMLPEPPDVLQG---MPLRIEYISVMAQAQKSIGLTSLSQTVGF 462
45580765 386 ERHEEKLLMLGPVLERMHNEILDPLIELTFQRMVEANILPPPPQEMQG---VDLNVEFVSMLAQAQRAIATNSVDRFVGN 462
41179382 386 ERHEEKLLMLGPVLERMHNEILDPLIELTFQRMVEANILPPPPQEMQG---VDLNVEFVSMLAQAQRAIATNSVDRFVGN 462
89152428 386 EMKEEKLLMLGPVLERLNDECLNPLIDRSFSMMVRKNMLPPPPDVMEG---MPLKVEYISVMAQAQKSIGLSSLASTVNF 462
48696640 386 VRYELMQRLLGPTLGRLENDFLSPMIQRTFNIRFRAGKLGELPSKLLEsgkAAMDIVYTGPLSRAQKIDQAASIERWAGS 465
48696684 466 TAQLAEINPEVLDIPDWDEMVRMLGSLLGAPQTLMRPKAKVTSIRKNRSQTQQKAEQAAIAEAEGNAMEAQGKGQAALKE 545
45569514 463 LGAVAGIKPEVLDKFDADRWADTYADMLGIDPELIVPGNQVALIRKQRADQQQAAQQAALLNQGADTAAKLGSVDTSKQN 542
48697195 467 LGIVSQFDPAAAKVPNGARIARLLADYGGVPVEAMSTDEELQAQQAAEAQAAQMQQMLAAAPVAAGAIKDLSDAQTAAQT 546
30387383 463 IGQLAQFKPEALDKLDVDQAIDAFSEMSGVSPTVIVPQEQVQGIREERAKQAQAAQAMAMGQAAAQGAKTLSETQTSDPS 542
45580765 463 LGAVAGIKPEVLDKFDADRWADTYADMLGIDPELIVPGNQVALIRKQRADQQQAAQQAALLNQGADTAAKLGSVDTSKQN 542
41179382 463 LGAVAGIKPEVLDKFDADRWADTYADMLGIDPELIVPGNQVALIRKQRADQQQAAQQAALLNQGADTAAKLGSVDTSKQN 542
89152428 463 IGQLAQVKPEALDKLNVDQAIDAFADMSGVSPTVIVPQEQVEQARQQRAQQQQQQQMMAMGMAAAQGVKTLSEAKTSDPS 542
48696640 466 TAQLAEINPEVLDIPDWDEMVRMLGSLLGAPQTLMRPKAKVTSIRKNRSQTQQKAEQAAIAEAEGNAMEAQGKGQAALKE 545
48696684 546 NQ 547
45569514 543 AL 544
48697195 547 AR 548
30387383 543 AL 544
45580765 543 AL 544
41179382 543 AL 544
89152428 543 VL 544
48696640 546 NQ 547
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap