Conserved Protein Domain Family
PHA00667

?
PHA00667: PHA00667 
hypothetical protein
Statistics
?
PSSM-Id: 106976
View PSSM: PHA00667
Aligned: 4 rows
Threshold Bit Score: 47.7131
Threshold Setting Gi: 41179395
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
41179395   1 MSLEAAIQENTSALRDLIAAIKAGVPTTAAQVAAVAAEAPAAQQEASTEKKPRATSAKTTAATAPTPPTAEVGAADAPES 80 
45569528   1 MSLEAAIQENTSALRDLIAAIKAGVPTTAAQVAAVAAEAPAAQQEASTEKKPRATSAKTTAATAPTPPTAEVGAADAPES 80 
48697231   1 MSLEAAIEANTAAIKELTAALIASGALQTAQASAALHSAPGVQAVATAQRQLKEKEADAAKKQD-AATDASAGAAATTES 79 
45580779   1 MSLEAAIQENTSALRDLIAAIKAGVPTTAAQVAAVAAEAPAAQQEASTEKKPRATSAKTTAATAPTPPTAEVGAADAPES 80 
41179395  81 KAENSAPVQAGDAGQDAAAG------------------DAAPTYQDTAD----AVTKLARVKGRDAAVAVLSKFGAAKLP 138
45569528  81 KAENSAPVQAGDAGQDAAAG------------------DAAPTYQDTAD----AVTKLARVKGRDAAVAVLSKFGAAKLP 138
48697231  80 KPSGATTAPTPEKSSDVPPGvelkpwadktleiyaelkDAEPTQENVKRlivfGINQKIPGDGRAIAEAVLARFGANAVS 159
45580779  81 KAENSAPVQAGDAGQDAAAG------------------DAAPTYQDTAD----AVTKLARVKGRDAAVAVLSKFGAAKLP 138
41179395 139 D------VKPEQFADVLAACNQAMEG 158
45569528 139 D------VKPEQFADVLAACNQAMEG 158
48697231 160 EkagkkgLSADQYPDVFAYGLRVLAG 185
45580779 139 D------VKPEQFADVLAACNQAMEG 158
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap