Conserved Protein Domain Family
PHA00665

?
PHA00665: PHA00665 
major capsid protein
Statistics
?
PSSM-Id: 106974
View PSSM: PHA00665
Aligned: 6 rows
Threshold Bit Score: 599.942
Threshold Setting Gi: 30387386
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
45569510   1 MPTLSTTNPTLADVAARMTPDGKIDpQIVEMLNETNEILDDMTVIEANGFTEHKTTVRSGLPTGTWRKLNYGVQPEKSRT 80 
48697198   1 MATLSTNNPTMADVAKRLDPNGKVD-IIVEMLNQTNPVLQDMTAIEGNLPTGHRTSVRTGLPTPTWRKLYGGVLPNKSST 79 
89152431   1 MAVKGLTALTLADWGKRVDPNGKVD-KIIELLGQTNPILQDMPFVEGNLPTGHRTTIRSGLPSATWRLLNYGVQPSKSTT 79 
41179378   1 MPTLSTTNPTLADVAARMTPDGKIDpQIVEMLNETNEILDDMTVIEANGFTEHKTTVRSGLPTGTWRKLNYGVQPEKSRT 80 
30387386   1 MALIGQTLPSLLDIYNRTDKNGRIA-RIVEQLAKTNDILTDAIYVPCNDGSKHKTTIRAGIPEPVWRRYNQGVQPTKTQT 79 
45580761   1 MPTLSTTNPTLADVAARMTPDGKIDpQIVEMLNETNEILDDMTVIEANGFTEHKTTVRSGLPTGTWRKLNYGVQPEKSRT 80 
45569510  81 VQVKDSMGMLETYAEVDKALADLNGNSAAWRLSEDRAFIEGMNQTQATTLFYGDSSIDAEKFMGLTPRFNSLS---AENG 157
48697198  80 AQVTDNCGMLEAYAEVDKALADLNGNTAAFRLSEDRAQIEGMNQEVAQTLFYGNDGIAPAEFTGLSPRYNSLS---AENK 156
89152431  80 VQVTDSVGMLETYAEVDKSLADLNGNTAEFRLSEDRAFIEAMNQQMAQTLFYGDSSVNPQQFMGLSSRYSSLS---AGNA 156
41179378  81 VQVKDSMGMLETYAEVDKALADLNGNSAAWRLSEDRAFIEGMNQTQATTLFYGDSSIDAEKFMGLTPRFNSLS---AENG 157
30387386  80 VPVTDTTGMLYDLGFVDKALADRSNNAAAFRVSENMGKLQGFNNKVARYSIYGNTDAEPEAFMGLAPRFNTLStskAASA 159
45580761  81 VQVKDSMGMLETYAEVDKALADLNGNSAAWRLSEDRAFIEGMNQTQATTLFYGDSSIDAEKFMGLTPRFNSLS---AENG 157
45569510 158 QNIIDAGGTGSDNASIWLTVWGPNTLHTIYPKGSQAGLQSRDLGEDTL--IDAAGGRYQGYRTHYKWDIGLTLRDWRYVV 235
48697198 157 DNVIDAGGTGSDNASAWLVVWGPNTCHSIYPKGSKAGLSVEDKGQVTIenADGNGGRMEGYRTHYKWDIGLTLRDWRYVA 236
89152431 157 QNIIDAGGTGTDNTSIWLVVWGENTVHGIFPKGKKAGIQMEDKGQVTL--EDANGGKYEGYRTHYKWDNGLALRDWRYVV 234
41179378 158 QNIIDAGGTGSDNASIWLTVWGPNTLHTIYPKGSQAGLQSRDLGEDTL--IDAAGGRYQGYRTHYKWDIGLTLRDWRYVV 235
30387386 160 ENVFSAGGSGSTNTSIWFMSWGENTAHMIYPEGMVAGFQHEDLGDDLV--SDGNGGQFRAYRDEFKWDIGLSVRDWRSIS 237
45580761 158 QNIIDAGGTGSDNASIWLTVWGPNTLHTIYPKGSQAGLQSRDLGEDTL--IDAAGGRYQGYRTHYKWDIGLTLRDWRYVV 235
45569510 236 RIANVDVSELTKNASAGAdLIDLMTQA--VELIPNVGMGRPAFYMPRKIRSFLRRQITNKVAAStLTMEEIAGKKVVAFD 313
48697198 237 RVCNIDVSDLATSANAQA-LIKYMIMA--AERIPQLGMGRAVWYMNRNLREKLRLGIVDKIANN-LTWETVSGERVMTFD 312
89152431 235 RIANIDVSNLSEPSSA-AnIAKLMVKA--LHRIPNRGMGRPVFYMNRTVGQALDLQSLEKTSLA-ISVKETEGEWWTSFR 310
41179378 236 RIANVDVSELTKNASAGAdLIDLMTQA--VELIPNVGMGRPAFYMPRKIRSFLRRQITNKVAAStLTMEEIAGKKVVAFD 313
30387386 238 RICNIDVTTLTKDASTGAdLISMMVDAyyARDVAMLGDGKEVIYANKTIHAWLHKQAMNAKNVN-LTIEEYGGKKIVSFL 316
45580761 236 RIANVDVSELTKNASAGAdLIDLMTQA--VELIPNVGMGRPAFYMPRKIRSFLRRQITNKVAAStLTMEEIAGKKVVAFD 313
45569510 314 GIPCRRTDALLLTEARVV 331
48697198 313 GIPVQRTDALLNTESRVV 330
89152431 311 GVPIRETDALLETEARVV 328
41179378 314 GIPCRRTDALLLTEARVV 331
30387386 317 GIPIRRVDAILNTESAVT 334
45580761 314 GIPCRRTDALLLTEARVV 331
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap