Conserved Protein Domain Family
PHA00664

?
PHA00664: PHA00664 
hypothetical protein
Statistics
?
PSSM-Id: 106973
View PSSM: PHA00664
Aligned: 6 rows
Threshold Bit Score: 153.133
Threshold Setting Gi: 30387387
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
89152432   1 MITDKLLMFSEAQAVTNTAASTDVIDLGPIDgkrRDIGVGYPLEFWALVNEAATASGEATVNIQLQTSENNSSWTTIYDS 80 
41179377   1 MIIDKLLQVSDGQAVTASAASTDVIDFGQAN---PNTGMDDRSKMVITVDESADAAGAATVTFSVQDSADNATFADVAAT 77 
48697199   1 MYIDSLLEFSRAQALSASGASTNIIDLGSDR----DIGPGRPLWVVVSPSVAADNTTGDETYSIALQTDDNAAFSSPTTI 76 
45569509   1 MIIDKLLQVSDGQAVTASAASTDVIDFGQAN---PNTGMDDRSKMVITVDESADAAGAATVTFSVQDSADNATFADVAAT 77 
45580760   1 MIIDKLLQVSDGQAVTASAASTDVIDFGQAN---PNTGMDDRSKMVITVDESADAAGAATVTFSVQDSADNATFADVAAT 77 
30387387   1 MLLDQQALFSAAQAITATAVSTNVIDTGSSK----DVGKYGDIPLLIQVVEAFNTLTSLTVTV---QTDDNSSFSSATDV 73 
89152432  81 GAL--AKTALTAGKRVvSAKVPAGVQRYLRVNYSVATGPLTAGEFTAGISLDVDANTPYPIRSKVT 144
41179377  78 GAI--GKANLAAGKQV-VIPMPTKLRRYCRVYYTVATGPLTAGKFSAQVVTGIQQNVAYPDSPRIA 140
48697199  77 ATVapAAASFGAGVRV-VIGMPFANERYLRLNYTLGG---TTPSVTLNAFLTDQDPASWQAYPDGI 138
45569509  78 GAI--GKANLAAGKQV-VIPMPTKLRRYCRVYYTVATGPLTAGKFSAQVVTGIQQNVAYPDSPRIA 140
45580760  78 GAI--GKANLAAGKQV-VIPMPTKLRRYCRVYYTVATGPLTAGKFSAQVVTGIQQNVAYPDSPRIA 140
30387387  74 ISMviPLASLTVGYKTpVITLPMKLERYIRLNYTVTGTAPTTGKVTAGIVGGVQTNV--------- 130
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap