Conserved Protein Domain Family
PHA00661

?
PHA00661: PHA00661 
hypothetical protein
Statistics
?
PSSM-Id: 106970
View PSSM: PHA00661
Aligned: 6 rows
Threshold Bit Score: 1126.18
Threshold Setting Gi: 45580757
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
30387391   1 MAFSWIQPSFAGGEIGPSLYGRIDMSKYQVALRKCDNFIVRQYGGVENRPGTRFVGPAKYPDRKCRLIPFQFSTVQTYAL 80 
48697202   2 PKAAPQQVSFDAGELSPLLGARVDLAKYPNGCQVMENFIATVQGPAIRRGGKRFVAATKDSTKQSWLLPFIVADGIAYML 81 
45580757   2 SNVRVLQRSFGGGEISPEMFGRIDDVKYQSGLAICRNFVVKPQGPAENRAGFAFVREVKDSAKKVRLIPFTYSVTQTMVI 81 
89152436   1 MAISWIQPSFAGGEIGPSLYGRIDMAKYQVALRKCDNFIVRQYGGVENRPGTRFVGAAKYPNRKCRLIPFQFSTVQTYAL 80 
41179374   2 SNVRVLQRSFGGGEISPEMFGRIDDVKYQSGLAICRNFVVKPQGPAENRAGFAFVREVKDSAKKVRLIPFTYSVTQTMVI 81 
45569506   2 SNVRVLQRSFGGGEISPEMFGRIDDVKYQSGLAICRNFVVKPQGPAENRAGFAFVREVKDSAKKVRLIPFTYSVTQTMVI 81 
30387391  81 EFGHNYMRVIKDGAYVLTTSnVIYELAMPYADTDL------FRIKFTQSADVLTLVHPAYPPKELRRYAHDNWQIVDVTT 154
48697202  82 EFGDHYIRFFVNRGQLVNAG-APVEIATPYALADLttedgtFAIRATQSADTMYLFHGGYPTQKLLRTSATTFSLQPVTF 160
45580757  82 ELGAGYFRFHTNGGTLLDGA-VPYEIANPYAEADL------FNIHYVQSADVLTLVHPNYAPRELRRLGATNWQLATIAF 154
89152436  81 EFGHQYMRVIKDGALVLNSSnVIYEIATPYTEADL------FRIKFTQSADVLTLVHPAYPPKELRRYAHDNWQLVDVVT 154
41179374  82 ELGAGYFRFHTNGGTLLDGA-VPYEIANPYAEADL------FNIHYVQSADVLTLVHPNYAPRELRRLGATNWQLATIAF 154
45569506  82 ELGAGYFRFHTNGGTLLDGA-VPYEIANPYAEADL------FNIHYVQSADVLTLVHPNYAPRELRRLGATNWQLATIAF 154
30387391 155 KNGPFEDINVDETVKVYASASTGTITLTASSAIFGAEQVGKLFYLEQPAVDSVPVWETSKTTAINDVRRADSNYYRANTS 234
48697202 161 VGGPFAAVNSDNNVRVHASAGTGAVTLVASASVFRPSDVGTLFYLEQEDNSFVKPWVVHQKIGPSELRRVGDRVYLCTAV 240
45580757 155 TS------PVATPTSVTATSNNKGTDYTYRYVVTALDAEGK------------------TESAPSSAGTCTNNLFTNGGA 210
89152436 155 KNGPFEDINIDESLTVYASASTGTITLTASASIFGAEQVGKLFYLEQPAVDSVPVWETSKSTSIGDIRRADSNYYRAVTA 234
41179374 155 TS------PVATPTSVTATSNNKGTDYTYRYVVTALDAEGK------------------TESAPSSAGTCTNNLFTNGGA 210
45569506 155 TS------PVATPTSVTATSNNKGTDYTYRYVVTALDAEGK------------------TESAPSSAGTCTNNLFTNGGA 210
30387391 235 GKT-----GTLRPSHTEGMSWDGWG-GTGS----DDTGIQWEYLHSGFGIAKI-----TAVAGDGLTATADVVSFIPSQV 299
48697202 241 GTAtpqvtGTETPTHTSGSRWDGTGqDESAtdeyGSIGAEWEYQHSGYGTVLItgytnDQVVTGTVATNDPADPGMLPNT 320
45580757 211 NTI----------------AWSASS-GASRynvyKEQGGLYGYIGQTTGTSLV-----DDNIAPDLSVTPPIYDAV---- 264
89152436 235 GKT-----GTLRPSHTEGTSWDGWG-GSGD----DDTGIEWEYLHSGFGIARI-------TAVNGTTATAEVISYIPSQV 297
41179374 211 NTI----------------AWSASS-GASRynvyKEQGGLYGYIGQTTGTSLV-----DDNIAPDLSVTPPIYDAV---- 264
45569506 211 NTI----------------AWSASS-GASRynvyKEQGGLYGYIGQTTGTSLV-----DDNIAPDLSVTPPIYDAV---- 264
30387391 300 VGSANASYKWAKYAWNSVNGYPSTVVYYQQRLYFAastaypQTIWASRTGDYKDFGKNN----PIQDDDRIIYTYAGRQV 375
48697202 321 VVTLTGTYKWARSLFNSTDGFPQMGTFWRNRLCLM------RDRWLAMSVSADFETFKTkdadQQTDDSAIVQQLNARQL 394
45580757 265 --------------FNAAGDYPAAVSYFEQRRCFAgttnkpQNIWMTRSGTESAMSYSL----PVRDDDRVAFRVAAREA 326
89152436 298 VGEDNASYKWAKYAWNSVNGYPGTVVYYQQRLYFAastafpQTIWASRTGDYKDFGKSN----PTQDDDRIIYTYAGRQV 373
41179374 265 --------------FNAAGDYPAAVSYFEQRRCFAgttnkpQNIWMTRSGTESAMSYSL----PVRDDDRVAFRVAAREA 326
45569506 265 --------------FNAAGDYPAAVSYFEQRRCFAgttnkpQNIWMTRSGTESAMSYSL----PVRDDDRVAFRVAAREA 326
30387391 376 NEIRHLIDVGNLVALTSGGEYTISGDQ-NKVLTPSAFSFSSQGNNGSSNVPPIAVANIALFIQEKGSVVRDLAYSFDVDG 454
48697202 395 NKLAWMVESDSLLIGMTGDEWVIGPANaSQPVSAANLNAARRTSYGSKRIQPVQVGGTIMFVQKAGRKLRDFKYDFSSDN 474
45580757 327 NAIRHIVPLTELLLLTSSGEWRVASVN-SDAVTPTTISVRPQSYVGATDVQPVVVNNTTIYGAARGGHVRELAYNWQANG 405
89152436 374 NEIRHLIDVGSLVALTSGGEYVITGDQ-NKVLTPSSFAFSSQGSNGSSNVPPIAVANIALFVQEKGSVVRDLAYSFDVDG 452
41179374 327 NAIRHIVPLTELLLLTSSGEWRVASVN-SDAVTPTTISVRPQSYVGATDVQPVVVNNTTIYGAARGGHVRELAYNWQANG 405
45569506 327 NAIRHIVPLTELLLLTSSGEWRVASVN-SDAVTPTTISVRPQSYVGATDVQPVVVNNTTIYGAARGGHVRELAYNWQANG 405
30387391 455 YQGTDLTILANHLF-----QKHSIVDWSFCIVPYSSAFCIRDDGKLLVLTYLRD---QQVFAWAPQSSAGKYESTCS--- 523
48697202 475 YVSTDVTKIADHITrgragTNSGIMSLCFQQEPHSVVWAARADGQLIGCTYDEEagrSDVYGWHRHPDANGFVECVAsmp 554
45580757 406 FVTGDLSLRAAHLF-----DNLDILDMAYAKAPQPIVWFISSSGKLLGLTYVPE---QQIGAWHQHDTDGVFESCAV--- 474
89152436 453 YQGNDLTILANHLF-----QKHSIVDWCFSIVPYSSAFCIRDDGKLLVMTYLRD---QQVFAWAPQSSTGKYESTCS--- 521
41179374 406 FVTGDLSLRAAHLF-----DNLDILDMAYAKAPQPIVWFISSSGKLLGLTYVPE---QQIGAWHQHDTDGVFESCAV--- 474
45569506 406 FVTGDLSLRAAHLF-----DNLDILDMAYAKAPQPIVWFISSSGKLLGLTYVPE---QQIGAWHQHDTDGVFESCAV--- 474
30387391 524 ISEGSEDAVYFVVNRTINGQTVRYIERLSSRLFT--NDEDAFFVDCGLSYDGRNTSSrtmtisggtgdwsyqvdypvtvs 601
48697202 555 APDGASDDLWVIVRRQVNGQTVRYVEYLNPALQDdePQSSAFYVDAGITYNGVPTST----------------------- 611
45580757 475 VAEGNEDRLYAVVRRTIGGNEVRYVERMASRQFD--AQADAFFVDSGLTYSGEPVSH----------------------- 529
89152436 522 ISEGNEDAVYFVVNRTVNGQTVRYIERLSSRLFT--SDEDAFFVDSGLSYDGRNTSDrtmtitggsgewdylaeytisvs 599
41179374 475 VAEGNEDRLYAVVRRTIGGNEVRYVERMASRQFD--AQADAFFVDSGLTYSGEPVSH----------------------- 529
45569506 475 VAEGNEDRLYAVVRRTIGGNEVRYVERMASRQFD--AQADAFFVDSGLTYSGEPVSH----------------------- 529
30387391 602 ggayfvntdvgaqiqfpytgtdpdtnepvakelrgdiisvtsntavvvrfnrnvppvlrnvattnwqmarqtFSGLAHLE 681
48697202 612 ------------------------------------------------------------------------IAGLGHLE 619
45580757 530 ------------------------------------------------------------------------ISGLEHLE 537
89152436 600 ggayftssdvgaqlqfpytgadpdtgyevskelrcdiisvtsntavvvranrnvppslrnvattnwqmarrtFGGLSHLE 679
41179374 530 ------------------------------------------------------------------------ISGLEHLE 537
45569506 530 ------------------------------------------------------------------------ISGLEHLE 537
30387391 682 GQTVNILSDASVEPQKTVTGGAVTLESPGAVVHIGLPITAEFETLDININGQETL-LDKKQVIPTVTMVVNASRGIWATT 760
48697202 620 GVTVAVLTDGAVHPSRTVTAGAITLDWSASIVHIGVPTTCRIQTMQLNAGAANGTaQGKTKRVTNIATRFSRSLGGVVGP 699
45580757 538 GKTVSILADGAVHPQRVVTDGAIDLDVEAGTVHIGLPITAELQTLPVAMQLDGSFgQGRVKNINKLWLRVHRSSGIFAGP 617
89152436 680 GQTVNILSDANVEPQKVVSGGAVTLESPGAVVHIGLPITAEFETLDININGQETL-LDKKQVIPSVTLVVNASRGIWATT 758
41179374 538 GKTVSILADGAVHPQRVVTDGAIDLDVEAGTVHIGLPITAELQTLPVAMQLDGSFgQGRVKNINKLWLRVHRSSGIFAGP 617
45569506 538 GKTVSILADGAVHPQRVVTDGAIDLDVEAGTVHIGLPITAELQTLPVAMQLDGSFgQGRVKNINKLWLRVHRSSGIFAGP 617
30387391 761 PGGTwyeyPQREFEFYDDPVDDATGKVEVK---LDSNW--DKNGRVKV--RQLDPLPLSVLAVLPRLTVGGF 825
48697202 700 TFDD----NDLEQLSFRKPSNAMDRAVPLFdgdMESDWrgGYEGQSWIcyQNDQPLPVTLLGFFPILDTQDD 767
45580757 618 HADAltevKQRTSEPYGSPPALKSEEIPLV---LSPKW--GDSGQLFV--RQADPLPLMIVSMSAEIAIGA- 681
89152436 759 PGGKwyeyPQREFEFYDDPVDDATGKVEVK---LDSNW--GKNGRVKI--RQLDPLPLSVLAVIPRLTVGGF 823
41179374 618 HADAltevKQRTSEPYGSPPALKSEEIPLV---LSPKW--GDSGQLFV--RQADPLPLMIVSMSAEIAIGA- 681
45569506 618 HADAltevKQRTSEPYGSPPALKSEEIPLV---LSPKW--GDSGQLFV--RQADPLPLMIVSMSAEIAIGA- 681
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap