Conserved Protein Domain Family
PHA00660

?
PHA00660: PHA00660 
hypothetical protein
Statistics
?
PSSM-Id: 133918
View PSSM: PHA00660
Aligned: 3 rows
Threshold Bit Score: 308.32
Threshold Setting Gi: 41179373
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
45569505   1 MGSGLVGSYYGARSQQSSLQFQSNIARINAGIANTNADTIESIGNANADAILATGDFNASIAELGAQSALEAGQQQIAAQ 80 
45580756   1 MGSGLVGSYYGARSQQSSLQFQSNIARINAGIANTNADTIESIGNANADAILATGDFNASIAELGAQSALEAGQQQIAAQ 80 
41179373  17 MGSGLVGSYYGARSQQSSLQFQSNIARINAGIANTNADTIESIGNANADAILATGDFNASIAELGAQSALEAGQQQIAAQ 96 
45569505  81 TLKAGQLKGAQRAALAANGIDLGEGSAAEVQVSSDIVKQIDTDTLRANAARTAWGYRAQGMEAQLQAGLQALNTRTQAKV 160
45580756  81 TLKAGQLKGAQRAALAANGIDLGEGSAAEVQVSSDIVKQIDTDTLRANAARTAWGYRAQGMEAQLQAGLQALNTRTQAKV 160
41179373  97 TLKAGQLKGAQRAALAANGIDLGEGSAAEVQVSSDIVKQIDTDTLRANAARTAWGYRAQGMEAQLQAGLQALNTRTQAKV 176
45569505 161 QGINLRTGAGSMEADALLKSGSAAGISPVGAGFSSLLSGAGDVADSWYRYSQSKG 215
45580756 161 QGINLRTGAGSMEADALLKSGSAAGISPVGAGFSSLLSGAGDVADSWYRYSQSKG 215
41179373 177 QGINLRTGAGSMEADALLKSGSAAGISPVGAGFSSLLSGAGDVADSWYRYSQSKG 231
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap