Conserved Protein Domain Family
PHA00658

?
PHA00658: PHA00658 
putative lysin
Statistics
?
PSSM-Id: 106967
View PSSM: PHA00658
Aligned: 3 rows
Threshold Bit Score: 1470.82
Threshold Setting Gi: 41179372
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
41179372   1 MPRVPVYDSPQVSPNTVPQARLATPSFATPTFRGADAPAFQDTANQQARQFSQGARQFSNDVGRIADSMVQQANQLRVDD 80 
45580755   1 MPRVPVYDSPQVSPNTVPQARLATPSFATPTFRGADAPAFQDTANQQARQFSQGARQFSNDVGRIADSMVQQANQLRVDD 80 
45569504   1 MPRVPVYDSPQVSPNTVPQARLATPSFATPTFRGADAPAFQDTANQQARQFSQGARQFSNDVGRIADSMVQQANQLRVDD 80 
41179372  81 ALNRAKEAALRLTYDKDTGFANLKGINALERPEGKPLADEYGDNLKKQLDEISGTLGNDAQRRAFALHSNDILTSFRGQA 160
45580755  81 ALNRAKEAALRLTYDKDTGFANLKGINALERPEGKPLADEYGDNLKKQLDEISGTLGNDAQRRAFALHSNDILTSFRGQA 160
45569504  81 ALNRAKEAALRLTYDKDTGFANLKGINALERPEGKPLADEYGDNLKKQLDEISGTLGNDAQRRAFALHSNDILTSFRGQA 160
41179372 161 VQHEASEYKTYALSTSEGIQSTALRDIALNWNNPDAINSAVDRIKAETFRQAQLLGKSAEWQEAQARKLTSNAHKIALMS 240
45580755 161 VQHEASEYKTYALSTSEGIQSTALRDIALNWNNPDAINSAVDRIKAETFRQAQLLGKSAEWQEAQARKLTSNAHKIALMS 240
45569504 161 VQHEASEYKTYALSTSEGIQSTALRDIALNWNNPDAINSAVDRIKAETFRQAQLLGKSAEWQEAQARKLTSNAHKIALMS 240
41179372 241 ALEQNNPTYASAYLNKYSGQMDADDILTVRGHITKDMDGRAGLAAATDAVGKVPIQVSDGERAFNIAVGTESGGRQFGAD 320
45580755 241 ALEQNNPTYASAYLNKYSGQMDADDILTVRGHITKDMDGRAGLAAATDAVGKVPIQVSDGERAFNIAVGTESGGRQFGAD 320
45569504 241 ALEQNNPTYASAYLNKYSGQMDADDILTVRGHITKDMDGRAGLAAATDAVGKVPIQVSDGERAFNIAVGTESGGRQFGAD 320
41179372 321 GKPLTSPKGAVGIAQVMPDTAPEAAKLAGLPWDENRYRNDAAYNRALGMAYFQKQLRDFGGDLPKAYAAYNAGPGALQSA 400
45580755 321 GKPLTSPKGAVGIAQVMPDTAPEAAKLAGLPWDENRYRNDAAYNRALGMAYFQKQLRDFGGDLPKAYAAYNAGPGALQSA 400
45569504 321 GKPLTSPKGAVGIAQVMPDTAPEAAKLAGLPWDENRYRNDAAYNRALGMAYFQKQLRDFGGDLPKAYAAYNAGPGALQSA 400
41179372 401 LKDAKDGNWLALLPKETQDYVVKNMQAYNAGQGRPARPTLADIEAQLQNDPRLAGNPERLKIARVEAERQFNMQTAALKQ 480
45580755 401 LKDAKDGNWLALLPKETQDYVVKNMQAYNAGQGRPARPTLADIEAQLQNDPRLAGNPERLKIARVEAERQFNMQTAALKQ 480
45569504 401 LKDAKDGNWLALLPKETQDYVVKNMQAYNAGQGRPARPTLADIEAQLQNDPRLAGNPERLKIARVEAERQFNMQTAALKQ 480
41179372 481 RDDEAVATALRGLYENGGRFSELPVSIRANIPPEKLTSVMGAAERIAKGDDTTSLWLYNKLTNSPDELARMSDNEFYALR 560
45580755 481 RDDEAVATALRGLYENGGRFSELPVSIRANIPPEKLTSVMGAAERIAKGDDTTSLWLYNKLTNSPDELARMSDNEFYALR 560
45569504 481 RDDEAVATALRGLYENGGRFSELPVSIRANIPPEKLTSVMGAAERIAKGDDTTSLWLYNKLTNSPDELARMSDNEFYALR 560
41179372 561 TSLSEADFKHFSQERAKRLGAAPSTNGPGDLNSQAIKAGLDTRLRMMGDDPTPKDGSSDAERVGAMRKFIDGYFIAAQRE 640
45580755 561 TSLSEADFKHFSQERAKRLGAAPSTNGPGDLNSQAIKAGLDTRLRMMGDDPTPKDGSSDAERVGAMRKFIDGYFIAAQRE 640
45569504 561 TSLSEADFKHFSQERAKRLGAAPSTNGPGDLNSQAIKAGLDTRLRMMGDDPTPKDGSSDAERVGAMRKFIDGYFIAAQRE 640
41179372 641 AGKKFTDAEVEQHLDALFMKNATVRGWFSNSSVPILSMKVGDIDSATKDGIKAAYKRAGIDSPTDAQILNAYWNLKVSRK 720
45580755 641 AGKKFTDAEVEQHLDALFMKNATVRGWFSNSSVPILSMKVGDIDSATKDGIKAAYKRAGIDSPTDAQILNAYWNLKVSRK 720
45569504 641 AGKKFTDAEVEQHLDALFMKNATVRGWFSNSSVPILSMKVGDIDSATKDGIKAAYKRAGIDSPTDAQILNAYWNLKVSRK 720
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap