Conserved Protein Domain Family
PHA00657

?
PHA00657: PHA00657 
crystallin beta/gamma motif-containing protein
Statistics
?
PSSM-Id: 106966
View PSSM: PHA00657
Aligned: 3 rows
Threshold Bit Score: 4188.76
Threshold Setting Gi: 41179371
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
41179371    1 MSNEFDAAVAGTLGQQPAQDTTADPFDAAVAGVLRPDQGQAARAGFVLASDTDPDAYAEAQRVARRANLPIETVLNQPKE 80  
45580754    1 MSNEFDAAVAGTLGQQPAQDTTADPFDAAVAGVLRPDQGQAARAGFVLASDTDPDAYAEAQRVARRANLPIETVLNQPKE 80  
45569503    1 MSNEFDAAVAGTLGQQPAQDTTADPFDAAVAGVLRPDQGQAARAGFVLASDTDPDAYAEAQRVARRANLPIETVLNQPKE 80  
41179371   81 AKRQDTIGAIDFDTLGKTSPATAALLADVEKAKIAHDNVDNMTGIESVLSSLGTAVKYLVSAPDQKNTLMGDIGAGFAQA 160 
45580754   81 AKRQDTIGAIDFDTLGKTSPATAALLADVEKAKIAHDNVDNMTGIESVLSSLGTAVKYLVSAPDQKNTLMGDIGAGFAQA 160 
45569503   81 AKRQDTIGAIDFDTLGKTSPATAALLADVEKAKIAHDNVDNMTGIESVLSSLGTAVKYLVSAPDQKNTLMGDIGAGFAQA 160 
41179371  161 NRGAAGLFQSVFELPNNLVGTILPANPLQPVADQFAQWGAQSKDLAKRLSPPQSDTLGSGVSSGVQSLTSNLLMLPLALL 240 
45580754  161 NRGAAGLFQSVFELPNNLVGTILPANPLQPVADQFAQWGAQSKDLAKRLSPPQSDTLGSGVSSGVQSLTSNLLMLPLALL 240 
45569503  161 NRGAAGLFQSVFELPNNLVGTILPANPLQPVADQFAQWGAQSKDLAKRLSPPQSDTLGSGVSSGVQSLTSNLLMLPLALL 240 
41179371  241 PGGQPAALGGMASMTGGQSYQDARSQGLTPAQALPFAVSQATIEYATEKLPVSRLIGDLHAGSPLLKTLAHQVATEVPGE 320 
45580754  241 PGGQPAALGGMASMTGGQSYQDARSQGLTPAQALPFAVSQATIEYATEKLPVSRLIGDLHAGSPLLKTLAHQVATEVPGE 320 
45569503  241 PGGQPAALGGMASMTGGQSYQDARSQGLTPAQALPFAVSQATIEYATEKLPVSRLIGDLHAGSPLLKTLAHQVATEVPGE 320 
41179371  321 QVATVLQDLNEWAVLPENKEKPFSAYLAERPSAAAQTLIATLVGVGGNVAVMRGIDRTITTADQRTQRAQAAQQQAELLA 400 
45580754  321 QVATVLQDLNEWAVLPENKEKPFSAYLAERPSAAAQTLIATLVGVGGNVAVMRGIDRTITTADQRTQRAQAAQQQAELLA 400 
45569503  321 QVATVLQDLNEWAVLPENKEKPFSAYLAERPSAAAQTLIATLVGVGGNVAVMRGIDRTITTADQRTQRAQAAQQQAELLA 400 
41179371  401 RLNQLAAADKVLARDPDTFEQFVANAAENGPVQQVFIDANTLMQSGLAEQVAAVSPAVAAQLPEALQTGGQVAIPVEEYA 480 
45580754  401 RLNQLAAADKVLARDPDTFEQFVANAAENGPVQQVFIDANTLMQSGLAEQVAAVSPAVAAQLPEALQTGGQVAIPVEEYA 480 
45569503  401 RLNQLAAADKVLARDPDTFEQFVANAAENGPVQQVFIDANTLMQSGLAEQVAAVSPAVAAQLPEALQTGGQVAIPVEEYA 480 
41179371  481 ARIAPTEATQGLLDHLKTEPEGFSRAEAQQYMQSQAEELRAEVERALGEQQGDDAFKQSAEAVRAAVKTQLDTAARFTPQ 560 
45580754  481 ARIAPTEATQGLLDHLKTEPEGFSRAEAQQYMQSQAEELRAEVERALGEQQGDDAFKQSAEAVRAAVKTQLDTAARFTPQ 560 
45569503  481 ARIAPTEATQGLLDHLKTEPEGFSRAEAQQYMQSQAEELRAEVERALGEQQGDDAFKQSAEAVRAAVKTQLDTAARFTPQ 560 
41179371  561 VNDAYSSMVGNFYAVQAARLGTTPEALFQQYPLRVAAESVAGGQQFDQEHGPFGPVLRDFQGDAKGAIAKLLEMKSGEAI 640 
45580754  561 VNDAYSSMVGNFYAVQAARLGTTPEALFQQYPLRVAAESVAGGQQFDQEHGPFGPVLRDFQGDAKGAIAKLLEMKSGEAI 640 
45569503  561 VNDAYSSMVGNFYAVQAARLGTTPEALFQQYPLRVAAESVAGGQQFDQEHGPFGPVLRDFQGDAKGAIAKLLEMKSGEAI 640 
41179371  641 GALHHPDIGDIDLVWGEEGTRRSDGYGLAKLAKWHPEVLDDLQGILSAMKVTSRTENRVNLESADHRAGVRLTWDDQAKH 720 
45580754  641 GALHHPDIGDIDLVWGEEGTRRSDGYGLAKLAKWHPEVLDDLQGILSAMKVTSRTENRVNLESADHRAGVRLTWDDQAKH 720 
45569503  641 GALHHPDIGDIDLVWGEEGTRRSDGYGLAKLAKWHPEVLDDLQGILSAMKVTSRTENRVNLESADHRAGVRLTWDDQAKH 720 
41179371  721 WLLTAFQKKGGVAGTRTGTTDLFVEDGTARPDDASDAIVDQKIDKFYQGGGRARGTFDPATLTVSLLKNADLSTFLHESG 800 
45580754  721 WLLTAFQKKGGVAGTRTGTTDLFVEDGTARPDDASDAIVDQKIDKFYQGGGRARGTFDPATLTVSLLKNADLSTFLHESG 800 
45569503  721 WLLTAFQKKGGVAGTRTGTTDLFVEDGTARPDDASDAIVDQKIDKFYQGGGRARGTFDPATLTVSLLKNADLSTFLHESG 800 
41179371  801 HFFLEVQLDIATRLAEKQRAGATLIDAETEVQRDAQTLLDWFGVRDLAAWNDLDFEAKRAHHEQFARGFEAYLFEGKAPS 880 
45580754  801 HFFLEVQLDIATRLAEKQRAGATLIDAETEVQRDAQTLLDWFGVRDLAAWNDLDFEAKRAHHEQFARGFEAYLFEGKAPS 880 
45569503  801 HFFLEVQLDIATRLAEKQRAGATLIDAETEVQRDAQTLLDWFGVRDLAAWNDLDFEAKRAHHEQFARGFEAYLFEGKAPS 880 
41179371  881 IEMHGLFQRFRAWLLNVYRDLKALNVELTPEVRNVFDRMLATGEQIALAEQGRSMMPLFATAEQAGMTPEEFAAYQALGV 960 
45580754  881 IEMHGLFQRFRAWLLNVYRDLKALNVELTPEVRNVFDRMLATGEQIALAEQGRSMMPLFATAEQAGMTPEEFAAYQALGV 960 
45569503  881 IEMHGLFQRFRAWLLNVYRDLKALNVELTPEVRNVFDRMLATGEQIALAEQGRSMMPLFATAEQAGMTPEEFAAYQALGV 960 
41179371  961 DATNDAIQDLQARGLRDMQWLHNARGRIIKQLQKDAAARRADVRRQVAEEVNAQPVYRADRFLRYGELELPPGAPQNVRR 1040
45580754  961 DATNDAIQDLQARGLRDMQWLHNARGRIIKQLQKDAAARRADVRRQVAEEVNAQPVYRADRFLRYGELELPPGAPQNVRR 1040
45569503  961 DATNDAIQDLQARGLRDMQWLHNARGRIIKQLQKDAAARRADVRRQVAEEVNAQPVYRADRFLRYGELELPPGAPQNVRR 1040
41179371 1041 AAEQANVDGAKLSLPALKEMYGEGENAIWRYLPTGKNGLAASEGMHPDTVAELFGFTSGDELVRRLLEAPPRGEEIEALT 1120
45580754 1041 AAEQANVDGAKLSLPALKEMYGEGENAIWRYLPTGKNGLAASEGMHPDTVAELFGFTSGDELVRRLLEAPPRGEEIEALT 1120
45569503 1041 AAEQANVDGAKLSLPALKEMYGEGENAIWRYLPTGKNGLAASEGMHPDTVAELFGFTSGDELVRRLLEAPPRGEEIEALT 1120
41179371 1121 DVRMLEQFGELSTPEAIERAADSAIHNDARARFVATEANALARVAAGPTQQIGTDRRGRPIVRRVLPEAAREYARALVSR 1200
45580754 1121 DVRMLEQFGELSTPEAIERAADSAIHNDARARFVATEANALARVAAGPTQQIGTDRRGRPIVRRVLPEAAREYARALVSR 1200
45569503 1121 DVRMLEQFGELSTPEAIERAADSAIHNDARARFVATEANALARVAAGPTQQIGTDRRGRPIVRRVLPEAAREYARALVSR 1200
41179371 1201 LKVRDIRPGQYTNAEVRAARNADRAMKAGDLATAAAEKRNQLIQHQAARAAYDAQDEVERGLRYLGKFAGDIKGIDVDYA 1280
45580754 1201 LKVRDIRPGQYTNAEVRAARNADRAMKAGDLATAAAEKRNQLIQHQAARAAYDAQDEVERGLRYLGKFAGDIKGIDVDYA 1280
45569503 1201 LKVRDIRPGQYTNAEVRAARNADRAMKAGDLATAAAEKRNQLIQHQAARAAYDAQDEVERGLRYLGKFAGDIKGIDVDYA 1280
41179371 1281 DQIANLLERFDLRKGQSLKAVDKRTALADWLRSQREAGFEPDIPAELENEAYRTSYKNMTVEEFRGLVDSVRQIEHLGRL 1360
45580754 1281 DQIANLLERFDLRKGQSLKAVDKRTALADWLRSQREAGFEPDIPAELENEAYRTSYKNMTVEEFRGLVDSVRQIEHLGRL 1360
45569503 1281 DQIANLLERFDLRKGQSLKAVDKRTALADWLRSQREAGFEPDIPAELENEAYRTSYKNMTVEEFRGLVDSVRQIEHLGRL 1360
41179371 1361 KRKLLTAADQRDYEAVRDEIAGSIRAHAQGRSADTRTPTTNAGRAVQGLKRFWASHIKAATWARVMDGGKDGGPMWEYFV 1440
45580754 1361 KRKLLTAADQRDYEAVRDEIAGSIRAHAQGRSADTRTPTTNAGRAVQGLKRFWASHIKAATWARVMDGGKDGGPMWEYFV 1440
45569503 1361 KRKLLTAADQRDYEAVRDEIAGSIRAHAQGRSADTRTPTTNAGRAVQGLKRFWASHIKAATWARVMDGGKDGGPMWEYFV 1440
41179371 1441 RSANERGDMETTMRAEATGKLSEILAPVFALGKMGGKGQHFPTIGRSLNREARLTIALNMGNEGNIQRLLGGEGWTPAQI 1520
45580754 1441 RSANERGDMETTMRAEATGKLSEILAPVFALGKMGGKGQHFPTIGRSLNREARLTIALNMGNEGNIQRLLGGEGWTPAQI 1520
45569503 1441 RSANERGDMETTMRAEATGKLSEILAPVFALGKMGGKGQHFPTIGRSLNREARLTIALNMGNEGNIQRLLGGEGWTPAQI 1520
41179371 1521 APVLQSLTAQEWQAVQAVWDHFEGYRPQIAAKERRVYGKEPAWVEPRPLTITTADGQTLTLRGGYYPIKYDPAASQRAEE 1600
45580754 1521 APVLQSLTAQEWQAVQAVWDHFEGYRPQIAAKERRVYGKEPAWVEPRPLTITTADGQTLTLRGGYYPIKYDPAASQRAEE 1600
45569503 1521 APVLQSLTAQEWQAVQAVWDHFEGYRPQIAAKERRVYGKEPAWVEPRPLTITTADGQTLTLRGGYYPIKYDPAASQRAEE 1600
41179371 1601 HSDAESARRQLQGAYTTATTRRSFTKSRVEEVSGRPLLYTLSGLYSGVNDVIHDLAWHEWLIDANRLLRSQTIDGAIREH 1680
45580754 1601 HSDAESARRQLQGAYTTATTRRSFTKSRVEEVSGRPLLYTLSGLYSGVNDVIHDLAWHEWLIDANRLLRSQTIDGAIREH 1680
45569503 1601 HSDAESARRQLQGAYTTATTRRSFTKSRVEEVSGRPLLYTLSGLYSGVNDVIHDLAWHEWLIDANRLLRSQTIDGAIREH 1680
41179371 1681 YGPEAKQQFKTWAADIAEGERGADAAVDIALSRLRQGVSASGLGFNVMSALMQPLGITQSIVRVGAPWVGRGVMKYLAAP 1760
45580754 1681 YGPEAKQQFKTWAADIAEGERGADAAVDIALSRLRQGVSASGLGFNVMSALMQPLGITQSIVRVGAPWVGRGVMKYLAAP 1760
45569503 1681 YGPEAKQQFKTWAADIAEGERGADAAVDIALSRLRQGVSASGLGFNVMSALMQPLGITQSIVRVGAPWVGRGVMKYLAAP 1760
41179371 1761 VGLTREINAKSSFMANRARTRFRELNELRNQVQDGSATKEWVGRNAYFLMMRCQQMVDVPTWWGAYEKAVAEGNDETRAV 1840
45580754 1761 VGLTREINAKSSFMANRARTRFRELNELRNQVQDGSATKEWVGRNAYFLMMRCQQMVDVPTWWGAYEKAVAEGNDETRAV 1840
45569503 1761 VGLTREINAKSSFMANRARTRFRELNELRNQVQDGSATKEWVGRNAYFLMMRCQQMVDVPTWWGAYEKAVAEGNDETRAV 1840
41179371 1841 SLADQAVIDSQGGGQTKDLSAIERGGPAQRLFTVFYSFMNTALNIGVAQTMSADTPAKRAKLAADYAMLYVVPAVLGYFL 1920
45580754 1841 SLADQAVIDSQGGGQTKDLSAIERGGPAQRLFTVFYSFMNTALNIGVAQTMSADTPAKRAKLAADYAMLYVVPAVLGYFL 1920
45569503 1841 SLADQAVIDSQGGGQTKDLSAIERGGPAQRLFTVFYSFMNTALNIGVAQTMSADTPAKRAKLAADYAMLYVVPAVLGYFL 1920
41179371 1921 KDALTPGDSGDDDPEKLAKKLLANQIDYLMGLMVVVREFGEAAKTVTGANDMGRDYTGPAGLRLIADVGRFATQTHQGEF 2000
45580754 1921 KDALTPGDSGDDDPEKLAKKLLANQIDYLMGLMVVVREFGEAAKTVTGANDMGRDYTGPAGLRLIADVGRFATQTHQGEF 2000
45569503 1921 KDALTPGDSGDDDPEKLAKKLLANQIDYLMGLMVVVREFGEAAKTVTGANDMGRDYTGPAGLRLIADVGRFATQTHQGEF 2000
41179371 2001 DDAFRKAAVNVVGDLFGLPSAQINRTVTGVQALAEGKTQNPAAIGFGFQEAR 2052
45580754 2001 DDAFRKAAVNVVGDLFGLPSAQINRTVTGVQALAEGKTQNPAAIGFGFQEAR 2052
45569503 2001 DDAFRKAAVNVVGDLFGLPSAQINRTVTGVQALAEGKTQNPAAIGFGFQEAR 2052
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap