Conserved Protein Domain Family
mtd

?
PHA00653: mtd 
major tropism determinant
Statistics
?
PSSM-Id: 164824
View PSSM: PHA00653
Aligned: 3 rows
Threshold Bit Score: 640.678
Threshold Setting Gi: 41179369
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
45569501   1 MSTAVQFRGGTTAQHATFTGAAREITVDTDKNTVVVHDGATAGGFPLARHDLVKTAFIKADKSAVAFTRTGNATASIKAG 80 
41179369   1 MSTAVQFRGGTTAQHATFTGAAREITVDTDKNTVVVHDGATAGGFPLARHDLVKTAFIKADKSAVAFTRTGNATASIKAG 80 
45580752   1 MSTAVQFRGGTTAQHATFTGAAREITVDTDKNTVVVHDGATAGGFPLARHDLVKTAFIKADKSAVAFTRTGNATASIKAG 80 
45569501  81 TIVEVNGKLVQFTADTAITMPALTAGTDYAIYVCDDGTVRADSNFSAPTGYTSTTARKVGGFHYAPGSNAAAQAGGNTTA 160
41179369  81 TIVEVNGKLVQFTADTAITMPALTAGTDYAIYVCDDGTVRADSNFSAPTGYTSTTARKVGGFHYAPGSNAAAQAGGNTTA 160
45580752  81 TIVEVNGKLVQFTADTAITMPALTAGTDYAIYVCDDGTVRADSNFSAPTGYTSTTARKVGGFHYAPGSNAAAQAGGNTTA 160
45569501 161 QINEYSLWDIKFRPAALDPRGMTLVAGAFWADIYLLGVNHLTDGTSKYNVTIADGSASPKKSTKFGGDGSAAYSDGAWYN 240
41179369 161 QINEYSLWDIKFRPAALDPRGMTLVAGAFWADIYLLGVNHLTDGTSKYNVTIADGSASPKKSTKFGGDGSAAYSDGAWYN 240
45580752 161 QINEYSLWDIKFRPAALDPRGMTLVAGAFWADIYLLGVNHLIDGTSKYNVTIADGSAPPKKSTKFGGDGSAAYSDGAWYN 240
45569501 241 FAEVMTHHGKRLPNYNEFQALAFGTTEATSSGGTDVPTTGVNGTGATSAWNIFTSKWGVVQASGCLWTWGNEFGGVNGAS 320
41179369 241 FAEVMTHHGKRLPNYNEFQALAFGTTEATSSGGTDVPTTGVNGTGATSAWNIFTSKWGVVQASGCLWTWGNEFGGVNGAS 320
45580752 241 FAEVMTHHGKRLPNYNEFQALAFGTTEATSSGGTDVPTTGVNGTGATSAWNIFTSKWGVVQASGCLWTWGNEFGGVNGAS 320
45569501 321 EYTANTGGRGSVYAQPAAALFGGSWHYTSNSGSRAAYWYSGPSNSPANIGARGVCDHLILE 381
41179369 321 EYTANTGGRGSVYAQPAAALFGGAWNGTSLSGSRAALWYSGPSFSFAFFGARGVCDHLILE 381
45580752 321 EYTANTGGRGSVYAQPAAALFGGSWFYTSYSGSRAAYWNAGPSNSSANIGARGVCDHLILE 381
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap