Conserved Protein Domain Family
PHA00652

?
PHA00652: PHA00652 
hypothetical protein
Statistics
?
PSSM-Id: 106964
View PSSM: PHA00652
Aligned: 3 rows
Threshold Bit Score: 261.548
Threshold Setting Gi: 45569500
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
45569500   1 MEPIEEATKCYDQMLIVERYERVISYLYPIAQSIPRKHGVAREMFLKCLLGQVELFIVAGKSNQVSKLYAADAGLAMLRF 80 
45580751   1 MEPIEEATKCYDQMLIVERYERVISYLYPIAQSIPRKHGVAREMFLKCLLGQVELFIVAGKSNQVSKLYAADAGLAMLRF 80 
41179368   1 MEPIEEATKCYDQMLIVERYERVISYLYPIAQSIPRKHGVAREMFLKCLLGQVELFIVAGKSNQVSKLYAADAGLAMLRF 80 
45569500  81 WLRFLAGIQKPHAMTPHQVETAQVLIAEVGRILGSWIARVNRKGQAGK 128
45580751  81 WLRFLAGIQKPHAMTPHQVETAQVLIAEVGRILGSWIARVNRKGQAGK 128
41179368  81 WLRFLAGIQKPHAMTPHQVETAQVLIAEVGRILGSWIARVNRKGQAGK 128
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap