Conserved Protein Domain Family
PHA00626

?
PHA00626: PHA00626 
hypothetical protein
Statistics
?
PSSM-Id: 106959
View PSSM: PHA00626
Aligned: 3 rows
Threshold Bit Score: 90.5529
Threshold Setting Gi: 9635496
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
13559827  1 MSCPKCGSGNIAKEKTMRGWSGDYVCCDCGYNDSKDAFGERGKNEFVKINKESEGNEKS 59 
9635496   1 MSCPKCGSGNIAKEKTMRGWSDDYVCCDCGYNDSKDAFGERGKNEFVRINKERKGNEKS 59 
24371541  1 MSCPKCGSGNIAKEKTMRGWSDDYVCCDCGYNDSKDAFGERGKNEFVRINKERKGNEKS 59 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap