Conserved Protein Domain Family
PHA00619

?
PHA00619: PHA00619 
CRISPR-associated Cas4-like protein
Statistics
?
PSSM-Id: 177290
View PSSM: PHA00619
Aligned: 7 rows
Threshold Bit Score: 274.049
Threshold Setting Gi: 45655883
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
42494952   87 KMSRLLHILYNYEIVSQNDTKNIWVTELSRCLRRSYLMRKEGKTKVGLNEAmkmHIGSGLHMRLQSLLRKHGFETEVRVQ 166
45655883   10 LLKNIIAETFKELSKPVDKLQYLTVTQISQCPRRSWYELKKGGLDLASEYA---DMGMVFHSLLEDAVKNRQELGKCYTE 86 
42495077    1 MKSRLLTIIADYQIINGNNSETIWVTELSRCLRQSFLMRKN-PVRPTLDTLmrmNIGSGLHMRLQKILAKHGFEVEKRVE 79 
38639823    1 -MSRLLTIIYNYEIVS-NDTQTIWVTELTRCLRRSWLMRKNGKVKLSHYEImkmHIGTGLHMRLQRILQKNGFETEVKVQ 78 
160688446   1 -MSRLLTILYNYEIVSQNDGKTIWVTELARCLRRSFLMRRQGRVKLKLEETmkmHIGSGLHIRLQRILEKHGFETEKRVE 79 
198449257   1 -MSRLLTILYNYEIVSQNDGKTIWVTELARCLRRSFLMRRQGRVKLKLEETmkmHIGSGLHIRLQRILEKHGFETEKRVE 79 
270281840   1 -MSRLLHIIYNNEIVSQNTSDTIWVTELTRCLRKSFLMRKNGKVKLNNYEImkmHIGTGLHMRLQRILQKNGFETEVKVQ 79 
42494952  167 RKTA---LGFQIVGRIDVY--DKEENVIYELKYTHNDKLDSVRLNNYLRQLNYYIEMANA--MKGYLVIVHADGSVEEIK 239
45655883   87 VDIAkpfYGIEIRGRIDTLciSRDAYRIIEFKTTNMQDGFKGIETAHLRQVSLYWYLTGSqpMRKEIYLVYIDRKTGEVK 166
42495077   80 RKTA---LGFNIVGKVDVY--DKEENTIYELKYTHQQSLDKIRLNNYLRQLNYYIEMANA--LAGYLIIVHADGRVEEIK 152
38639823   79 KKTA---LGFIVVGKIDVY--DKEEGTVYELKYTHLDELDRPRLNNYLRQLNYYIEMANA--LAGYLIIVHADGRVEEIK 151
160688446  80 RKTA---LGFQIVGKVDIY--DKEENTIYELKYTHNDKLDNVRLNNYLRQLNYYIEMINA--MAGYLIIVHADGRVEEIK 152
198449257  80 RKTA---LGFQIVGKVDIY--DKEENTIYELKYTHNDKLDNVRLNNYLRQLNYYIEMINA--MAGYLIIVHADGRVEEIK 152
270281840  80 KKTA---LGFTVVGKIDIF--DREENTVYELKYTHLDELDRPRINNYLRQLNYYIEMINA--MAGYLVIVHADGRVEEIK 152
42494952  240 -------RDWAETDLEKRANAFGIYVEENTLPpkKSRPDAECIECPFYNFC--WGKL 287
45655883  167 vinmrheSILKKRELGNRIKYLVRSFNENKVP--KPEPGRSCIFCPYKTVCkaWKRS 221
42495077  153 -------RDYSETDLEARANTFGISVEENILPpkKVKPDVECVECPFYNYC--W-RD 199
38639823  152 -------RDWAETDLEARANAFGISVEENILPprKSKQDSECAECPFYNFC--WRGD 199
160688446 153 -------RDWSETDLESRANAFGISVEENILPprKSKQDSECAECPFFNLC--WSGD 200
198449257 153 -------RDWSETDLESRANAFGISVEENILPprKSKQDSECAECPFFNLC--WSGD 200
270281840 153 -------RDWSETDLESRANAFGISVEENILPpkKTKFDSECLECPFFNLC--WSGD 200
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap