Conserved Protein Domain Family
PHA00617

?
PHA00617: PHA00617 
ribbon-helix-helix domain containing protein
Statistics
?
PSSM-Id: 177289
View PSSM: PHA00617
Aligned: 8 rows
Threshold Bit Score: 83.8808
Threshold Setting Gi: 42494949
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
42495074   1 MKARVEYIKLPRPSYAKTYRKMEVTKRnGGTIELTLEDTMQVISFKLPPEMNAKLDSVALRQGKSKSQIIREALARYLEN 80 
38639819   3 MKARVEYIKLPKSSYSKSYRKIEVTKK-DGIIELTLTQTMDVVSFKLPPEMNAKLEQVASKLKKTKSEIIREALEKYLSN 81 
9625534    1 MKARVEYIKLPR-CYTKTYRKIEAKKNnDGTIELTLEETMQVISFKLPPALNAKLEQIAIKEKKSKSEIIRIALARYVEN 79 
42494949   1 MKARVEYIKLPKSYSPRK------------------DWDMDVISFKLPPELKAKLERVAYERKVSRSELIRIAITKYLEE 62 
160688442  1 MKAKVEYIKLPKSSYSRSYRKIEVTRK-GDTIELTLTESMDVVSFKLPPQLNAKLEEFAVKMKKTKSEIIREALEKYLGE 79 
198449253  1 MKAKVEYIKLPKSSYSRSYRKIEVTRK-GDTIELTLTESMDVVSFKLPPQLNAKLEEFAVKMKKTKSEIIREALEKYLGE 79 
270281806  1 MKAKVEYIKLPT-SHSRSYRKIEATRK-GDTIELTLEDTMDVVSFKLPPQMNKKLEEVAIKTKKSKSEVIREALEKYLGE 78 
270281837  1 MKAKVEYIKLPKSSYSRSYRKIEVTRS-GDTIELTLTETMDVISFKLPPEMNAKLEQVASKMKKTKSEIIREALEKYLSN 79 
42495074  81 V 81 
38639819  82 W 82 
9625534   80 V 80 
42494949  63 V 63 
160688442    -    
198449253    -    
270281806    -    
270281837 80 W 80 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap