Conserved Protein Domain Family
PHA00616

?
PHA00616: PHA00616 
hypothetical protein
Statistics
?
PSSM-Id: 177288
View PSSM: PHA00616
Aligned: 7 rows
Threshold Bit Score: 61.3196
Threshold Setting Gi: 270281808
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
270281808  1 MYQCLKCGKIFKYKREIKKHIKQVHNAqiSELTLELSYIKFNVKRR 46 
45655872  10 VYQCLRCGLTFRTKKQLIRHLVNTEKV--NPLSIDYYYQSFSVSLK 53 
9625536    1 MYQCLRCGGIFNKRREVVEHLLVGHKHk-DRLTLDFYYIYFRVRGQ 45 
42495076   1 MYQCLRCGGIFRKRREVVEHLLSGHMQ--SKFTLEYFYVYFRVRE- 43 
38639821   4 MYQCLRCGSIFDKRSEVIEHLLSVHGQm-NKVTLEYFYIYFKVRRP 48 
160688444  3 MYQCIRCGQIYRKKKEVMQHLIKDHRQ--GTFTLEYFYMYFRVRE- 45 
198449255  3 MYQCIRCGQIYRKKKEVMQHLIKDHRQ--GTFTLEYFYMYFRVRE- 45 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap