Conserved Protein Domain Family
PHA00547

?
PHA00547: PHA00547 
hypothetical protein
Statistics
?
PSSM-Id: 164822
View PSSM: PHA00547
Aligned: 4 rows
Threshold Bit Score: 477.899
Threshold Setting Gi: 9633977
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
20514688    1 MKKFIFFFKNYcYISGSMLLFSLIDLLLWIISLYCVGLVFWILFALQCVYFVWWLWKNIFYQLNAFRLVNFVWDNPLSVI 80 
9633977    14 NIKFSYWFVNW-FIANILFYLFIVCFNLQFIYFSSTSVTDIILFIFLVIFDIIFFWSFFSNLFQTRKLIKIIKSSPISII 92 
40806926    1 MKKFIFFFKNYcYISGSMLLFSLIDLLLWIISLYCVGLVFWILFVLQCIYFVWWLWKNIFYQLNSFGLVNFVWDNPLSVI 80 
160688405   1 MKNFVFFFKNYcYISGSMFLFSLIDLLFWIISLYCVGLVFWLLFALQCVYFVWWLWKNIFYQLNAFRLVQFIWDNPLSVI 80 
20514688   81 IGKLGTGKTLLLTYLSQTMKLltDEIYSNYPLEDDKVKVLTFKNLDFTDRTKPVPPDDSVILFDESYLYIDGTSPHDEKK 160
9633977    93 NGALGTGKTLLMTYLSQIAKF--DNVYSNYFINDEKIGVLGLNHLDFKNKNYKIPPNDSLILFDEIFLYMNGAKPEENNK 170
40806926   81 IGKLGTGKTLLLTYLSQTMKLltDEIYSNYPLEDDKVKVLTFKNLDFTDRTKPVPPDDSVILFDESYLYIDGTSPHDEKK 160
160688405  81 IGKLGTGKTLLLTYLSQTMKLltDEIYSNYPLEDDKVKFLTFKNLDFTDITKRVPPDDSVILFDESYLYIDGTSPHDEKK 160
20514688  161 VHSGKIPWIVLARHFRHRALFTAQREGMIWNNIRQLASGIIIPISLKKPvakkgfNFFNRFFIMRMGIFQDITDYEIWKT 240
9633977   171 KFSGLIPYFLLCRQFDNNIVFAGQRINQNWVEYREIANMIIVPMQCIKP------SIFFPYFKMKIGFFDDLDDYLVWKT 244
40806926  161 VHSGKIPWIVLARHFGNRALFTAQREGMIWNNIRQLASGIIIPISLKKPvikkgfNFFNRFFIMQIGIFQDITDYEIWKT 240
160688405 161 VHSGKIPWIVLARHFGNRALFSAQREGMIWNNIRQLASGIIIPISLKKLvakkgfNFFNRFFIMRIGIFQDITDYEIWKT 240
20514688  241 KSVERTAEGKRAKHKSDVGLGIRFFKIIIPLEFANKYDSEWLKFVRDLKNDEIVNEKFYYWSEITKLSVK-ERLELFDID 319
9633977   245 ETVKRTANGKRVRKKSNKDIGINFVKITIPLSIAMQYDSKYLKFVRDLKNDKVPSYIKQNWPSIVKKDITiNELREMGME 324
40806926  241 KSVERTAEGKRVKHKSDVGLGIRFFKIIIPLEFANKYDSQWLKFVRDLKNDEIVNKKEYYWSEITKLSVK-ERLELFDID 319
160688405 241 KSVERTAEGKRVKHKSDVGLGIRFFKIIIPLEFANKYDSQWLKFVRDLKNDEIINKKEYYWSEITKLSVK-ERLELFDID 319
20514688  320 ILKKNLkprkekGNGKDD 337
9633977   325 HLLKNL------GELEND 336
40806926  320 ILKKNLkpkkekGNGKDD 337
160688405 320 ILKKNLkpkkekGNRKDD 337
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap