Conserved Protein Domain Family
PHA00542

?
PHA00542: PHA00542 
putative Cro-like protein
Statistics
?
PSSM-Id: 106954
View PSSM: PHA00542
Aligned: 5 rows
Threshold Bit Score: 52.8777
Threshold Setting Gi: 45569524
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
45569524   1 MEKAMPATTPTIPAAYTQRPDELVCALIRAGWSQEQIADATDVSQPTICRIYSGRHKDPRYSVVEKLRHLVLNLDDFQQV 80 
9633551    5 IFKHLKEMNNWRKTVYKKSPIEIVQALLAQGLTQSEIEANTGIKQPSISRILTGKNKDPRISTMVALEKLYLELATNSFS 84 
41179392   1 MEKAMPATTPTIPAAYTQRPDELVCALIRAGWSQEQIADATDVSQPTICRIYSGRHKDPRYSVVEKLRHLVLNLDDFQQV 80 
45580775   1 MEKAMPATTPTIPAAYTQRPDELVCALIRAGWSQEQIADATDVSQPTICRIYSGRHKDPRYSVVEKLRHLVLNLDDFQQV 80 
212499707  5 IFKHLKEMNNWRKTVYKKSPIEIVQALLAQGLTQSEIEANTGIKQPSISRILTGKNKDPRISTMVALEKLYLELATNSFS 84 
45569524  81 TR 82 
9633551   85 TS 86 
41179392  81 TR 82 
45580775  81 TR 82 
212499707 85 TS 86 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap