Conserved Protein Domain Family
PHA00540

?
PHA00540: PHA00540 
hypothetical protein
Statistics
?
PSSM-Id: 133910
View PSSM: PHA00540
Aligned: 3 rows
Threshold Bit Score: 1216.4
Threshold Setting Gi: 160688403
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9626113     1 MKKSLSLFAIFILTFLGLVIPFITLTAFRPLNEEQYTLKQESSTGKGINETDFINTMFLRSSFFENWSETNYFINPTLKT 80 
20514679    1 MRKSLSLFSIFILIFLGLVIPFITLTAFRPLNEEQYTLKQESSTGKGINETDFINTMFLRSSFFENWSETNYFINPTLKT 80 
160688403   1 MKKSLSLFAIFILSFLGLVIPFITLTAFRPLNEKYYTLKQENSTGKGINETDFINTMFLRSSFFENWSETNYFINPTLKT 80 
9626113    81 SKNLLFNDKWYLDFLQDSYSTGVVYDKPGEIFLNYYRQWHSLKNKYMVEKFYDVKKENFLNDLTDFIYAFAVKYKMFDVS 160
20514679   81 SKNLLFNDKWYLDFLQDSYSTGVVYDKPNEVFLNYYQQWHSLKNRYMVEKFYDVKKENFLNDLIDFIYAFAVKYKMFNVS 160
160688403  81 SKKLLFNDKWYLDFLQDSYSTGVVYDKPSSSFFSFYHMWDSWKNTYMVEKFYDVKKENFLNDLTDFIYAFAVKYNMYDVS 160
9626113   161 KEIVENVDRYKENHYPRVKLKQDNWKLITDYNWLKD-NFDNKYYFVIWKQSYSKEWEIMKFKHNMRYDMKi--------- 230
20514679  161 KEIVKNVDRYKENHYPRVKLNQDNWKLIDDIENVDKyKWEDETYIGITKIWKNKEWNWIIEDWKLHPPFS---------- 230
160688403 161 KKIVDNVERYKENHYPRVKLKQDNWKLITDYNYFDK-NIDDKWYFLFLKD-EKKELRNLKFKNNSNNAYGiiesngfiff 238
9626113   231 -----ESYIknNSFKGLYRWDGDGEPQTPTIDKNTGEITDWNSYQQSRVKQFIDLSLYSVLQENIRVQQGGSADYENPNK 305
20514679  231 -----NVYL--SSYKAIYRWTGVGKPQLPTIDKNTGEITDWNSYQQTRVKEFIDLSLYSVLLENTRVQQGGSADYENPNK 303
160688403 239 kylikNTYLrkGLIKGFYRWDGDGEPETPTINENTGEITDWNTYQQNFVKEFIDYSLTAVLQENIRVQQGGSADYENPNK 318
9626113   306 VGTKRIIFDFETVDELDVKNIKKAIYRMILTVDEANLIISGSLELNNINNDDLSFNFSFMRTGMGEVFNFNGSIYSSLNS 385
20514679  304 VGTKRIIFDFETVDELDVKNIKKAIYRMILTVDEANLIISGSLELNNINNDDLSFNFSFMRTGMGEVFNFNGSIYSSLNS 383
160688403 319 VGTKRIIFDFETVDELDVKNIKKSIYRMILTVDEANLIISGSLELNNVNSDDLSFNFSFIRTGTGEVFNFNGSIYSSINN 398
9626113   386 KDLKYYQQFSGQFDLSKFLQSFFASALVPVFQNRSLFIENGYIDNLQYDTVLVNFFALKLQNFNNILLIENINDKLQFDK 465
20514679  384 KDLKYYQQFSGQFDLSKFLQSFFASALVPVFQNRSSFIENGYIDNLQYDTVLVNFFALKLQNFNNILLSENINDKLQFDK 463
160688403 399 KDLRYFQQFNGRFDLSNFLQSFFASALVPVFQNRSSFIENGYIDNLQYNTVLVNFFALKLKNFNNILLSENINDKLQFDK 478
9626113   466 LLNSMFKISQKFYTNYLRTIFDLENNTYVQGYNKKYGLLVNNGFKIYPRYFYFSDKYKQLDIKLYSAFKNRFYTINNYGS 545
20514679  464 LLNSMFKISQKFYTNYLRTIFDLENNTYVQGYNKKYGLLVNNGFKIYPRYFYFSDKYKQLDIKLYSAFKNRFYTINNYGS 543
160688403 479 LLNSMFKISQKFYTNYLRTIFDLENNTYVQGYNKKYGLLVNNGFKIYPRYFYFSDKYKQLDIKLYSAFKNRFYTINNYGS 558
9626113   546 VFNYDFSVANNYNIKLNSGYVFGGDLQNKYGLQYKKIEEQKIGYNVFELQAQKENDMYRYYDFNFGIYNWQEINNGGLFP 625
20514679  544 VFNYDFSVANNYNISLNSGYVFGGDLQNKYGLQYKKIEEQKIGYNVFELQAQKENDMYRYYDFNFGIYNWQEINNGGLFP 623
160688403 559 VFNYDFSVANNYDIKLNSGYVFGGDLQSKYGLQYKKIEEQKIGYNVFELQAQKENDMYRYYDFNFGIYNWQEINSGGLFP 638
9626113   626 DKQWWQVQYVTPKGWWDFGAHIKNAVIWIVNTIPGVKQVNELASGVGKVFETVYSFFSQIFEVWKFNPALYSTITNIFLL 705
20514679  624 DKQWWQVQYITPKGWWDFGAHIKNAVIWIVNTIPGVKQVNELASGVGKVFETVYSFFSQIFEVWKFNPALYSTITNIFLL 703
160688403 639 DKQWWQVQYVTPEGWWYFGAHIKNAVIWIVNTIPGVKQVNELASGVGKVFETVYSFFSQIFEVWKFNPALYNTITNIFLL 718
9626113   706 IIFMKFVRLI 715
20514679  704 IIFMKFVRLI 713
160688403 719 IIFMKFVRLI 728
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap