Conserved Protein Domain Family
PHA00515

?
PHA00515: PHA00515 
hypothetical protein
Statistics
?
PSSM-Id: 133909
View PSSM: PHA00515
Aligned: 2 rows
Threshold Bit Score: 80.2552
Threshold Setting Gi: 23455829
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
18071310  1 MKADLINKRPKRYSTMFPKLVFSKKLPQAIRRTGQRASpVGQVSRREWQPRRD 53 
23455829  1 MKADLINKRPKLYSTMFLNLVFSKKLPQAIRRTGQRAS-VGQVSRREWQPRRD 52 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap