Conserved Protein Domain Family
PHA00510

?
PHA00510: PHA00510 
transcriptional regulator
Statistics
?
PSSM-Id: 133907
View PSSM: PHA00510
Aligned: 3 rows
Threshold Bit Score: 202.095
Threshold Setting Gi: 12248111
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
12248111    1 MVVTQGGIYHNLKESRYVITceNGLVTYFFSSKMYMHKFLNTYKENREKNNIKMSKlLKDFTSDIDLLSDICYYKQVEKR 80 
22855151    1 MPRTARGIYHNLKESEYVVS--NGDATFFFSSELYLNKFLDGYQKHREEFNKKINR-ITDTPLNMDMLADITFYSNVEKR 77 
194186876   1 MPKTQRGIYHNLKESEYVAS--NTDVTFFFSSELYLNKFLDGYQEYRKKFNKKIER-VAVTPWNMDMLADITFYSEVEKR 77 
12248111   81 GFLVLYKGDEMTWQESQTLGLQRRNEKKSLNYQEVSRLKLRDYLRIMD 128
22855151   78 GFHTWLKGCNASWQEIHVYALRTMTKPCTQNWSRIRKPKLAERRKNMV 125
194186876  78 GFHAWLKGDNATWREVHVYALRIMTKPNTLDWSRIQKPRLRERRKSMV 125
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap