Conserved Protein Domain Family
PHA00453

?
PHA00453: PHA00453 
hypothetical protein
Statistics
?
PSSM-Id: 164815
View PSSM: PHA00453
Aligned: 4 rows
Threshold Bit Score: 46.5343
Threshold Setting Gi: 30387456
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
31880045  24 MRNFEKLTRKPANRFGM-EEGKTGAKRNKPTRDRVSKRAvWEY 65 
30387456   1 MRNFEKMTKRSNRNAHDrFEVTKGRKFNKPLRTRAHKRN-WEG 42 
9627433    1 MRNFEKMTKRSNRNARD-FEATKGRKLNKTKRDRSHKRS-WEG 41 
194100365  1 MRNFEKMTKRANRNAHD-FEATKGRKFNKPLRTRAHKRC-WEG 41 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap