Conserved Protein Domain Family
PHA00451

?
PHA00451: PHA00451 
protein kinase
Statistics
?
PSSM-Id: 177283
View PSSM: PHA00451
Aligned: 10 rows
Threshold Bit Score: 580.979
Threshold Setting Gi: 281416281
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
194100469   1 MNYTDIQARLAIIKSLPIRELDKRQPLLVELAADIVNGETNNGNDTD--GSKGLEYQDWWHILGSLMGDAGFHLLGNGHF 78 
9633996     1 MTFTEAQATLEAIRNLPIDRLDERQPMLVALAAAIVNAETQDGQLTQdaGNKALEHMDYWQTLAERMRDVGFIKLGNGHF 80 
9627431     1 MNITDIMNAIDAIKALPICELDKRQGMLIDLLVEMVNSETCDGELTE--LNQALEHQDWWTTLKCLTADAGFKMLGNGHF 78 
17570791    1 MTFTEAQAALEAIRNLPIERLNERQTMLVALAAAIVNAETQDGQLTQaaGNTALERMDYWQTLAARMRDVGFIKLGNGHF 80 
119637749   1 MNYTDIQARLAIIKSLPIRELDKRQPLLVELAADIVNGETNNGNDTD--GSKGLEYQDWWHILGSLMGDAGFNLLGNGHF 78 
189427199   1 MTFTEAQAALEAIRNLPIERLNERQPMLVALAAAIVNAETQDGELTQakGNWGLESMDYWQTLAERMRDVGFVRLGNGHF 80 
194100419   1 MNYTDMQERLDVVRNLPICELDKRQPLLVALMADIVNAETSDGDDTD--SGWGLERQDYWQTLKIKAKDAGFNLLGNGHF 78 
194100255   1 MNYTDIQARLAIIKSLPISELDKRQTLLVALAADIVNGETSDGNDTE--GSNGLEYQDWWNTLGALMRDAGFRMLGNGHF 78 
212671386   1 MNYTDIQARLAIIKSLPISELDKRQPLLVALAADIVNGETSDGNDTE--GSNGLEHQDWWHTLGALMRDAGFKMLGNGHF 78 
281416281   1 MNYTDMQERLDVIRNLPICELDKRQPLLVALIADIVNYETSDGDDTD--SDWGLERQDYWQTLKIKAKDAGFNLLGNGHF 78 
194100469  79 SAAYSHKMLPGRVIKVGFKKEDSGAAYTAFCRMHQGRAGIPNIYHVARHAGCYTVVLDHLNS----CNRDANETHANYAY 154
9633996    81 SAAYEHALLPGKVIKVGFKKEDSGAAYAAFCRMNQGREGIPTVYDIQRHAGCYTVVLDYLNPlndwCYGESDKVRHHFKA 160
9627431    79 SAAYSHPLLPNRVIKVGFKKEDSGAAYTAFCRMYQGRPGIPNVYDVQRHAGCYTVVLDALKD----CERFNNDAHYKYAE 154
17570791   81 SAAYQHEMLPGKVIKVGFKKEDSGAAYAAFCRMNQGREGIPTVYDIQRHAGCYTVVLDYLNPlndwCYGESDKVRHHFKA 160
119637749  79 SAAYSHKMLPGRVIKVGFKKEDSGAAYTAFCRMHQGRAGIPNIYHVARHAGCYTVVLDHLSD----CKRDTNETHANYAY 154
189427199  81 SAAYEHALLPGKVIKVGFKKEDSGAAYAAFCRMNQGREGIPTVYDIQRHTGCYTVVLDYLTPlndwCYGESDKIRHHFQA 160
194100419  79 SAAFKHELLPGRAIKVGFKKEDSGAAYVAFCRMHQGRVGIPNVYHVARHAGCYTVVLDELEP----CQRSGNDEHEHYAD 154
194100255  79 SAAYSHEMLPGRVIKVGFKKEDSGAAYTAFCRMHQGRAGIPNVYHVARHAGCYTVVLDKLVA----CDRDNYDHEVYADL 154
212671386  79 SAAYSHEMLPGRVIKVGFKKEDSGAAYTAFCRMHQGRAGIPNVYHVARHAGCYTVVLDRLKS----CDRYANDVHAKYAS 154
281416281  79 SAAFKHELLPGRVIKVGFKKEDSGAAYVAFCRMHQGRVGIPNVYHVARHAGCYTVVLDELEP----CQRRANDAHGHYAD 154
194100469 155 AARALIECDDTNVEACAHfvSTEFIETCKMIREFFYGIASFDMHSGNIMFDKNDVAYITDPVSFSHDREREDG-FPLDPD 233
9633996   161 AREIIEEDCFDAAEEYPI--SDGFIETCKDIRKFFLGIASFDCHSGNMMKDQMGRLIITDPVSFSADDKLKPGeFHCDPD 238
9627431   155 IASDIIDCNSDEHDELTGw-DGEFVETCKLIRKFFEGIASFDMHSGNIMFSNGDVPYITDPVSFS--QKKDGGaFSIDPE 231
17570791  161 AREIIEEDCFDAAEEYPI--SDGFIETCKDIRKFFLGIASFDCHSGNMMKDQMGRLIITDPVSFSADDKLKPGeFHCDPD 238
119637749 155 AARALIECNDINVEACAHfvSTEFIETCKMIREFFYGIASFDMHSGNIMFDKNDVAYITDPVSFSHDREREDG-FPLDPD 233
189427199 161 AQEIIQEDCFDTAEEYPI--SEGFIETCKDIRKFFLGIASFDCHSGNMMKDQMGRLIITDPVSFSADDKLKPGeFHCDPD 238
194100419 155 LAYYFVEGESDPADYSEG--DQPFIETCQMIRKFFYGIASFDMHSGNIMFTKDGKPVITDPVSFSADRDREP--FSLEPE 230
194100255 155 ARYFVESDCHDASDFAPG--DYEFIETCQLIRKFFKGIASFDMHSGNIMFSEDGTPYITDPVSFSHDREREDG-FPLDPD 231
212671386 155 AAQEFIECSGGDANWYAQyvSKEFIETCKMIREFFHGIASFDMHSGNIMFDDNDVPYITDPVSFSHDREREDG-FPLDPD 233
281416281 155 LAYYFVEGESDPEDYTED--DQPFIETCQMIRKFFYGIASFDMHSGNIMFTPDGKPVITDPVSFSHDREREA--FSLEPE 230
194100469 234 ALIAEVEAIANERVIERCRNRKAKRDPNGTFRAEHKAAMKRRKRNRKLSERRAERvakcatkcatkkdhlhLVSLQREHK 313
9633996   239 ELIAELEALRAQEAIDRCKARKARRDPKGDFQAARKARAKWRRKASKRDKRNAKV----------------LAKMRMDAN 302
9627431   232 ELIKEVEEVARQKEIDRAKARKERHEGRLEARRFKRRNRKARKAHKAKRERM-------------------LAAWRWAER 292
17570791  239 ELIAEIEALRAQEAIERCVNRKARRDPKGAFQVARKARVKWRRKAAKREKCNAKV----------------LARMRMDAN 302
119637749 234 ALIAEVEAIANERIIERCRNRKAKRDPNGTFRAEHKAAMKRRKRNRKLSECRAERvakcet----kqdhlhLMSLQREHK 309
189427199 239 ELIAEIEALRAQEAIDRCKARKARRDPKGDFQVARKARAKWRRKASKREKRNAKV----------------LAKMRMDAN 302
194100419 231 DLLAEIEQIAHDKMIERCKRNKAKRDPNGELRIARRKANKERRARRKAHARWRKE------------------------- 285
194100255 232 ALIAEVEAIANERMIERCRNRKAKRDPNGTFQVNHKAAMKRRKRNRKLRAKRGAEva------------qhFVQRRHEQK 299
212671386 234 ALIAEVEAIANERIIERCRNRKAKCDPNGTFQVNRKAAMKRRKRNRKLRAKIAERdr------------lhFMAIRRERG 301
281416281 231 ELLAEIEQIAHDKMIERCKRNKAKRDPNGTFQRDRKYANKARRARAKVRARHKKE------------------------- 285
194100469 314 VIERNERRAEMLMGSV-WHDFRLLNGNSTVHKVNQVNDFKWQVADGLAIQAGCSLMIDKILDAQLMG 379
9633996   303 EQRRAEPRARMLWGDKhWRNAWMQHMNVDFARLELLAAAQMAQIDHKAIAWNAPLCVDKYLDRRLQG 369
9627431   293 QERRNHEVAVDVLGRTnNAMLWVNMFSGDFKALEERIALHWRNADRMAIANGLTLNIDKQLDAMLMG 359
17570791  303 QNRRDEPRARMVWGDKhWRNAWMHHNNLNFAELERRAAAVMMLHDEVRIQWGKPLHIDAYLDKRLQG 369
119637749 310 VIERNERRAEMLMGSV-WHDFRLLNGNSTIHKVNQVNDFKWQVADGLAIQAGCSLMIDKILDAQLMG 375
189427199 303 QNRRDEPRARMVWGDKhWRNAWMHHNNLNFAELERRAAAAMMMHDEVRIQWGKPLHIDAYLDKRLQG 369
194100419 286 -----------------RERINADALKFDLAKIEERV-LAWQMGPGLAIQMGKPLPLDNYLQGRLMG 334
194100255 300 QELRDAMRAQDWMGAHnWHNMWLHNNNADVIMIDKVKAFEWKQAERMALMQCRSLPIDKLLDAQLQG 366
212671386 302 VIERNERRAEMLMGSA-WHDFWLRNGNATVRKVDQVNGLKWQLGDRLAIQAGRPLNIDKVLDSKLMG 367
281416281 286 -----------------REQYHVDALKLDLAKIEERV-LAWHMGPGLAIQMGKPLPTDNYLQGRLMG 334
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap