Conserved Protein Domain Family
PHA00448

?
PHA00448: PHA00448 
hypothetical protein
Statistics
?
PSSM-Id: 133894
View PSSM: PHA00448
Aligned: 9 rows
Threshold Bit Score: 74.9837
Threshold Setting Gi: 9634017
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
119637763  1 MFNFINTLGKLVVKLYFCEAKRINNKARKDAERAQRLAKHARMLSEAASAGVTSAAKIAAKATDLDKFFL 70 
9627451    1 MFKLIKKLGQLLVRMYNVEAKRLNDEARKEATQSRALAIRSNELADSASTKVTEAARVANQAQQLSKFFE 70 
9634017    1 MFKFINALGKLVVKLYFIEAKKLDKKAKADSQRAIELAKQSREKSDAAVSGIHKSAAIAAKAQSMSKFFE 70 
30387471   1 MFKLIKKLGQLLVRMYNVEAKRLNDEARKEATQSRALAIRSNELADSASTKVTEAARVANQAQQLSKFFE 70 
17570809   1 MFKFINTLGKLVVKLYFIEAKKLDKKAKADSQRAIELAKQSREKSDAAVSGVHKSAAIAAKAQSMSKFFE 70 
189427217  1 MFKFINALGKLVVKLYFIEAKKLDKKAKADSQRAIELAKQSREKSDAAVSGIHKSAAIAAKAQSMSKFFE 70 
194100381  1 MFKLIKKLGQLLVRMYNVEAKRLNDEARKEATQSRTLAIRANELADSASNKVTEAARVANQAQQLSKFFE 70 
194100486  1 MFNFINTLGKLVVKLYFCEAKRINNKARKDAERAQRLAKHARMLSEAASAGVTSAAKIAAKATDLDKFFL 70 
194100273  1 MFKFINTLGKLVVKMYFREAKRLNDKARKDAEQAQRLAKQARLLSEDASAGVTSAAKIAAKATDLNKFFL 70 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap