Conserved Protein Domain Family
PHA00447

?
PHA00447: PHA00447 
lysozyme
Statistics
?
PSSM-Id: 177282
View PSSM: PHA00447
Aligned: 19 rows
Threshold Bit Score: 213.871
Threshold Setting Gi: 160700618
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
68299737    1 MANFKKRTHTKAILVHCTATKPHQDIGVREVRQWHtRDNGWFDVGYHFIIRRNGVIENGRPVDVVGAHASGFNSDSIGVC 80 
29366713    3 KVQFKPRPATDFIVVHCAATKASMDIGVREIRQWH-VQQGWLDIGYHFVIRRNGTVENGRPHDVIGSHVKNYNSRALGIC 81 
77118183    4 KVQFNPRSRTDAIFVHCSATKPEMDIGVETIRMWH-KQQAWLDVGYHFIIKRDGTVEEGRPVNVVGSHVKDWNSRSVGVC 82 
119637759   3 KVQFKPRSSTEAIFVHCSATKPTMDVGVREISQWH-KEQGWLAIGYHFVIRRDGTIEEGRPVEVIGSHVKSWNSKSVGVC 81 
194473818   3 KVQSKPRKETKYIFVHCSATRPSQDVGVREIRQWH-KEQGWLDVGYHFVIKRDGTIETGRSLEAVGSHVKGYNEVSVGIC 81 
194100268   3 KVQFKPRAVSEAIFVHCSATKATMNVGLREIRQWH-KEQVWLDVGYHFIISRDGRIEEGRPVGVVGSHVKDWNSKSVGVC 81 
194100326   4 KVQFNPRSRTDAIFVHCSATKPEMDIGVETIRMWH-KQQGWLDVGYHFIIKRDGTVEEGRPVNVVGSHVKDWNSKSVGVC 82 
194100481   3 KVQFKPRSSTEAIFVHCSATKPTMDVGVREISQWH-KEQGWLAIGYHFVIRRDGTIEEGRPVEVIGSHVKSWNSKSVGVC 81 
212671398   3 KVQFKPRAVTEAIFVHCSATKATMNVGLREIRQWH-KEQGWLDVGYHFIIRRDGTIEEGRPVDVVGSHVKDWNSKSVGVC 81 
281416293   3 KVQFTKRQETSQIFVHCSATKATMDVGVREIRQWH-KEQGWLDVGYHFIIRRDGTVEAGRDQDAVGSHVKGYNSTSVGVC 81 
68299737   81 LVGGINEEGKADANFTLEQYVSLKTLLDTLKASYPEAEIKGHRDVNNgKECPSFDIHGLLANVK 144
29366713   82 LAGGIDDKGQPQNNFTPEQFASLKLLLIANKRQYPQAQIVGHHDLDSgKACPSFKVSDWLKTAG 145
77118183   83 LVGGINAKGQFEANFTPAQMNSLRNKLDDLKVMYPQAEIRAHHDVAP-KACPSFDLQRWLSTNE 145
119637759  82 LVGGIDDKGHFEANFTPAQMVSLKEKLADLMNMYPEAEVKAHHDVAP-KACPSFNLSHWLKTGE 144
194473818  82 LVGGIDDQGKPNANFTVAQMESLKAVLKEVGETYPEATIMAHHDVAP-KACPSFHVRRWLKGDG 144
194100268  82 LVGGIDDKGRHEANFTPAQMHSLKEKLADLLDMYPDAEVKAHHDVAP-KACPSFNLSRWLKTGE 144
194100326  83 LVGGIDAKGKFEANFTPAQMNSLRNKLADLKAMYPQAEIKAHHDVAP-KACPSFDLQRWLATNE 145
194100481  82 LVGGIDDKGHFEANFTPAQMVSLKEKLADLMNMYPEAEVKAHHDVAP-KACPSFNLSHWLKTGE 144
212671398  82 LVGGIDDKGRHEANFTPAQMHSLKEKLADLKDLYPDAEIKAHHDVAP-KACPSFNLSRWLKTGE 144
281416293  82 LVGGIDAKGNPEANFTPAQMQALRSLLVELKVQYTGAVLMAHHDVAP-KACPSFDLKRWWEKNE 144
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap