Conserved Protein Domain Family
PHA00446

?
PHA00446: PHA00446 
hypothetical protein
Statistics
?
PSSM-Id: 177281
View PSSM: PHA00446
Aligned: 12 rows
Threshold Bit Score: 118.417
Threshold Setting Gi: 281416297
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9627452     1 MSNvAETIRLSDTADQWNRRVHINVRNGKATMVYRWKDSKSSKNHTQRMTLTDEQALRLVNALTKAAVTAIHEAGRVNEA 80 
9634018     5 ITH-ANTIRLPDTADQFSRRVHINVRGEKVTMVYRWKDHKSPKAHTQRMTLDDKQVGRLMGALTMAADKVVGDNRERLVE 83 
17570810    5 IKH-ANTIRLPDTADQFARRVHINVRGEKVTMVYRWKDHKSPKAHTQRMTLDDKQVGRLMGALTMAADNVVGDNRERLVE 83 
119637764   3 IKFpGNTIRLSDTVDQYARRVHVNVRNGKVTLVYRWKDHKSTKAHTQRVTLDDMQAGRLLSSVAVAATVAVGGDNVRQAM 82 
30387472    1 MSNvAETIRLSDTADQWNRRVHINVRNGKATMVYRWKDSKSSKNHTQRMTLTDEQALRLVNALTKAAVTAIHEAGRVNEA 80 
189427218   5 ITH-ANTIRLPDTADQFSRRVHINVRGEKVTMVYRWKDHKSPKAHTQRMTLDDKQVGRLMGALTMAADKVVGDNRERLVE 83 
194100382   1 MSNvAETIRLSDTADQWNRRVHINVRNGKATMVYRWKDSKSSKNHTQRMTLTDEQALRLVNALTIAAVTAIHETGRVNEA 80 
194100437   5 VKFpGNTIQLSDTVDQWGRKVHINVRNDKVTLVYRWKAKSDNRAHTQRVTLDDTQAARLLASVAVAATVAIGEDKVREAI 84 
194100487   3 IKFpGNTIRLSDTVDQYARRVHVNVRNGKVTLVYRWKDHKSTKAHTQRVTLDDMQAGRLLSSVAVAATVAVGGDNVRQAM 82 
194100275   3 IKFpGNTIRLSDTVDQYARRVHINVRNGKVTLVYRWKDHKSTKAHTQRVTLDDTQAGRLLASVAVAATVAVGEDKVRGVL 82 
194473822   1 MSKvSQTIPMSDTVDAYQRKIHINVRNGKVTMVHRWKDRYSDKRHTQRMTLTDAQAEHLLKVLQSAHARATLDNAMAAVR 80 
281416297   5 AKFpGNTIQLSDTADQWGRKVHINVRNDKVTLVYRWKAKSDNRAHTQRVTLDDVQAARLLASVAVAATVAVGADKVREVI 84 
9627452    81 MAILDKIDN 89 
9634018    84 FGAGMQEII 92 
17570810   84 FGAGMQEII 92 
119637764  83 LGNTIEAEG 91 
30387472   81 MAILDKIDS 89 
189427218  84 FGAGMQEII 92 
194100382  81 MAIIDKYLR 89 
194100437  85 LSKEVGETS 93 
194100487  83 LGNTIEAEG 91 
194100275  83 LGKTVEAEG 91 
194473822  81 NMK------ 83 
281416297  85 LSKEVGSTA 93 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap