Conserved Protein Domain Family
PHA00440

?
PHA00440: PHA00440 
host protein H-NS-interacting protein
Statistics
?
PSSM-Id: 133889
View PSSM: PHA00440
Aligned: 7 rows
Threshold Bit Score: 154.616
Threshold Setting Gi: 194100279
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9634023     1 MAMTKHFKVTFDVTAVIDSESEKNLNELLVDLAKKAGAGEKL-NPFKQELLIQGLTHGPEGAAAFCIKQGLREFIRDGHS 79 
17570815    1 MAITKKFKVSFDVTLKLDSETEELMREKILDLAHRAGAGEEI-TPMDRELLVQALTRGPDGAAAFAVRQGIRNAVKEMFE 79 
30387475    1 MTITKKFKVSFDVTLKLDSETEELMREKILDLAHRAGAGEEI-APMDRELLVQALTRGPDGAAAFAVRQGIRTNVKEMFE 79 
9627456     1 MAMTKKFKVSFDVTAKMSSDVQAILEKDMLHLCKQVGSGAIVpNGKQKEMIVQFLTHGMEGLMTFVVRTSFREAIKDMHE 80 
194100279   1 MAITKRFKVSFEMTVKVDSETEVMIQERILDLARSVRDGEEV-SAQDKELLVQALTHGADGVVAFAVKQGIRNEIREMGI 79 
194100385   1 MAMTKKFKVSFDVTAKMPSDVQAILEKDMLHLCKQVGSGEIVpNGKQKEMIVQFLTHGMEGLMAFVVRTSFREAIKDMHE 80 
189427220   1 MAMTKHFKVTFDVTAVIDSESEKNLNELLVDLAKKAGAGEKL-NPFKQELLIQGLTHGPEGAAAFCIKQGLREFIRDGHS 79 
9634023    80 ElsSTEQKLMRFSPATVREVF 100
17570815   80 E--TSDKSLLKLSPATVREVF 98 
30387475   80 E--SGDKSMFKVSPATVREVF 98 
9627456    81 E--YADKDSFKQSPATVREVF 99 
194100279  80 E---HHGEGIKFAPATIREVK 97 
194100385  81 E--YSDKDSFKLSPATVREVF 99 
189427220  80 ElsSTEQKLMRFSPATVREVF 100
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap