Conserved Protein Domain Family
PHA00438

?
PHA00438: PHA00438 
hypothetical protein
Statistics
?
PSSM-Id: 133887
View PSSM: PHA00438
Aligned: 15 rows
Threshold Bit Score: 122.955
Threshold Setting Gi: 29366723
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
17570820   1 MLQPINHVLTHPDDIPSMPRAAKEYLQVRFNQAYVMESGEYRALRAAGYSESFIAGVMHGLYLASRTLDEIEVRKEQLRQ 80 
9634029    1 MLQPINHVLTHPDDIPSMPRAAKEYLQVRFNQTYVMESGEYRALRAAGYSESFIAGVMHGLYLASRTLDEIEVRKEQLRQ 80 
119637771  1 MLTPIKKYMENPQDIPNVPRSVMEYLQVQYNAGYAIQSGLINRLKQAGWSESYIAGFLAGLNYASQTLDDMEAIRKEQAE 80 
29366723   1 MLKVIQHHIQNPDDIPDIAPAAAEYLAVRLNASYLIATGIVDDLRKQGYSEGYIAGFLDGANAAVEITELMQEAQLQKEE 80 
77118192   6 IENVVKQLQEERLDVPNISQSAIQFLHVLFNASYAEKMGAISLLKQQGYSDAFIAGFIKGLQYCSDTLDSAIAMRRELKD 85 
194100284  1 MLTPIKKYMENPQDIPNVPRSVMEYLQVQYNAGYAIQSGLINRLKQAGWSESYIAGFLAGLNYASQTLDDMEAIRKEQAE 80 
194100445  1 MLKPIEHILNNPNDLPDVPRAVKEYLQSRFNADFLYQS-EVRKLREAGHSEEFISGVLYGHYMASRVLDEMEGRQRALKE 79 
194100493  1 MLTPIKKYMENPQDIPNVPRSVMEYLQVQYNAGYAIQSGLINRLKQAGWSESYIAGFLAGLNYASQTLDDMEAIRKEQAE 80 
189427227  1 MLQPINHVLTHPDDIPSMPRAAKEYLQVRFNQAYVMESGEYRALRAAGYSESFIAGVMHGLYLASRTLDEIEVRKEQLRQ 80 
212671408  1 MLTPIKKYMENPQDIPNVPRATMEYLQVQYNAGYAIQSGLINRLKQAGWSESYIAGFLAGLNYASQTLDDMEAIRKEQAE 80 
17570820  81 E 81 
9634029   81 E 81 
119637771 81 S 81 
29366723     -    
77118192  86 T 86 
194100284 81 S 81 
194100445 80 G 80 
194100493 81 S 81 
189427227 81 E 81 
212671408 81 S 81 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap