Conserved Protein Domain Family
PHA00426

?
PHA00426: PHA00426 
type II holin
Statistics
?
PSSM-Id: 164801
View PSSM: PHA00426
Aligned: 18 rows
Threshold Bit Score: 70.2397
Threshold Setting Gi: 82793122
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
119637784  1 MLSLDFNNEVVKAAPIVGTGVADGAARLFFGLSLNEWFYVAAIAYTVAQIGAKVVDVIIKWKKEGRD 67 
82793122   2 SLEVQFGDTVIRSVPVVGAAGVDVVTRIF-GLTLSDWFYVAAIGYTVVQAWAVLYKTL---KRKEDK 64 
77118206   1 MIELDFKNEVLKASPIVGTAAADGASRFFFGLTLNEWFYVAAIAYTVVQIGVLVYKTI---KGGGKT 64 
30387496   1 MLSLDFNNELIKAAPIVGTGVADVSARLFFGLSLNEWFYVAAIAYTVVQIGAKVVDKIIDWKKATKE 67 
194100459  1 MLSLDFNNEVIKAAPIAGVAGADGVARLFWGLSLNEWFYVAAIAYTVVQIGAKVVDKIIDWKKANKE 67 
194100352  1 MIELDFKNEVLKASPIVGTAAADGASRFFFGLTLNEWFYVAAIAYTVVQIGVLVYKTI---KGGGKT 64 
194100405  1 MLSLDFNNELIKAAPIVGTGVADVSARLFFGLSLNEWFYVAAIAYTVVQIGAKVVDKIIDWKKATKE 67 
189427241  1 MLSLDFNNEAIKAAPIAGVAGADGVARLFWGLSLNEWFYVAAIAYTVVQIGAKVVDKIIDWKKANKE 67 
194473842  1 MLNFDFNNEILKAAPIAGAVGADGVARLFWGLSLNEWFYVAAIAYTVVQIGAKVIDKVIDYKKASGG 67 
281416317  1 MLSLDFNNEVIKAAPIAGVAGADGVARLFWGLSLNEWFYVAAIAYTVVQIGAKVVDKIIDWKKANKE 67 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap