Conserved Protein Domain Family
PHA00425

?
PHA00425: PHA00425 
DNA packaging protein, small subunit
Statistics
?
PSSM-Id: 164800
View PSSM: PHA00425
Aligned: 17 rows
Threshold Bit Score: 117.596
Threshold Setting Gi: 82793123
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9627479    2 EKDKSLITFLEMLDTAMAQRMLADLSDHERRSPQLYNAINKLLDRHKFQIGKLQPDVHILGGLAGALEEYKEKVGDNGlT 81 
77118207   1 MTQMDLEKFLLMLDTERARLMLQDLRDDSKRSPQLYNAIEKLLARHNFVLSKVSVDEKTLADMEALNAEYDKVLSATE-D 79 
82793123   1 ---MNLEQLLQALDSESARLMLEDLKDPEKRTPQLYNAIGKLLDRHKFNISKVQPDESILGELASAL--------PDDvT 69 
119637785  2 SNDKSLIQFLEMLDTEMAQRMLKDLQDDEKRTPQLYNAIGKLLERHKFQVSKLQPDRNILGGLADGLEEYQNLVGADGlT 81 
29366739   1 MSDNVLEKLLEAIDTETGRALLSDLRDDDRRSPQLYNAIGKYLERHKFTIAKLKPDESLLGDLAAALNEFPE-LGEDElY 79 
194473843  5 DNDNGLAKLLEMIDTELAKQLLADLKNDERRKPQLYSAINQYLLRHKFHLAKLQPDTEVLGELGDALAEYKSQYGSDGlS 84 
194100460  1 ---MDLIKFLEMLDTEMAQQMLMDLKNPEKRTPQLYNAIGKLLERHKFQISKLTPDVNILGGLAEGLEAYNSKVGADGlT 77 
194100508  2 SNDKSLIQFLEMLDTEMAQRMLKDLQDDEKRTPQLYNAIGKLLERHKFQVSKLQPDRNILGGLADGLEEYHSMVGADGlT 81 
212671423  2 SNDKSLIQFLEMLDTEMAQRMLADLQNDERRTPQLYNAIGKLLERHKFQVSKLQPDRNILGGLADGLEEYQNMVGSDGlT 81 
281416208  1 ---MNLEQLLQALDSESARLMLEDLKDPEKRTPQLYNAIGKLLDRHKFNISKVQPDESILGELASAL--------PDDvT 69 
9627479   82 DDDIYTLQ 89 
77118207  80 NDTGYGVQ 87 
82793123  70 ESDLYTLN 77 
119637785 82 EDEKYTLN 89 
29366739  80 GDGVRH-- 85 
194473843 85 EDEVYRH- 91 
194100460 78 DDDTFTLQ 85 
194100508 82 EDEKYTLN 89 
212671423 82 EDEKYTLN 89 
281416208 70 ESDLYTIN 77 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap