Conserved Protein Domain Family
PHA00422

?
PHA00422: PHA00422 
hypothetical protein
Statistics
?
PSSM-Id: 133878
View PSSM: PHA00422
Aligned: 17 rows
Threshold Bit Score: 109.118
Threshold Setting Gi: 281416186
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
29366721   1 MNEYLVTLWGLKKAARAYQSDFVRGRIALVNEAACRGHISCLSTAGKNMGFWSLTTSGQQFLAQYGGAL 69 
17570816   1 MSDYLKVLQAIKGCPKTFQSNYVRNNASLVAEAASRGHISCLTTSGRNGGAWEITASGTRFLKRMGGCV 69 
77118190   1 MSEYLRVLAALKSCPKTFQSNYVRNNAALVAEAASRGHLSCLSMDGRNNGAWEITAAGTKFLNQHGGCL 69 
9627458    1 MSDYLKVLQAIKSCPKTFQSNYVRNNASLVAEAASRGHISCLTTSGRNGGAWEITASGTRFLKRMGGCV 69 
30387476   1 MSDYLKVLQAIKGCPKTFQSNYVRNNASLVAEAASRGHISCLTTSGRNGGAWEITASGTRFLKRMGGCV 69 
194100441  1 MSEYLKVLAALKGCPKSFQSNYVRNNAALVAEAASRGHISCLTMSGRNGGAWEITSAGVKFLKAHGGCL 69 
194100386  1 MSDYLKVLQAIKCCPKTFQSNYVRNNASLVAEAASRGHISCLTTSGRNGGAWEITASGTRFLKRMGGCV 69 
194100332  1 MSEYLRVLAALKSCPKTFQSNYVRNNAALVAEAASRGHLSCLSMDGRNNGAWEITAAGTKFLNQHGGCL 69 
189427222  1 MSEYLKVLAAIKGCPKSFQSNYVRNNAALVAEAASRGHISCLTVGGRNGGAWEVTASGVRFLKRMGGCV 69 
194473826  1 MDNYLKVLRTIKSCPKSFQSNYARENAALIAEAASRGHLSCLDAQGRNTYVWEVTTGGVVFLSLYGGAV 69 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap