Conserved Protein Domain Family
PHA00406

?
PHA00406: PHA00406 
hypothetical protein
Statistics
?
PSSM-Id: 164797
View PSSM: PHA00406
Aligned: 9 rows
Threshold Bit Score: 38.2485
Threshold Setting Gi: 194100466
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
194100466  1 MRLLLTLLRHRATWRFLLVLAGALGASLVTqQQLSGLETLVCSLLTCSD 49 
30387503   2 FRLLLNLLRHRVTYRFLVVLCAALGYASLT-GDLSSLESAVCSILTCSD 49 
17570841   2 LRLLIALLRHRVTWRFLLVLTATLGYAGLN-DHLGQLEVAFCSILSCGD 49 
9627485    2 FRLLLNLLRHRVTYRFLVVLCAALGYASLT-GDLSSLESVVCSILTCSD 49 
9634051    2 LRLLIALLRHRVTWRFLLVLTATLGYAGLT-DHLGQLEVAFCSILSCGD 49 
194100413  2 FRLLLNLLRHRVTYRFLVVLCAALGYASLT-GDLSSLESTVCSILTCSD 49 
194100303  4 LSVLKTLATHRVTYKFLVVLAASIGLASSA-EHIGELETLLCSLLTCVS 51 
189427248  2 LRLLIALLRHRVTWRFLLVLAATLGYAGLT-DHLGQLEVAFCSILSCGD 49 
212671428  4 LSVLKTLATHRVTYKFLAVLAASIGLASSA-EHIGELETLLCSLLACVP 51 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap