Conserved Protein Domain Family
PHA00404

?
PHA00404: PHA00404 
hypothetical protein
Statistics
?
PSSM-Id: 164796
View PSSM: PHA00404
Aligned: 7 rows
Threshold Bit Score: 44.5875
Threshold Setting Gi: 194100465
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9627484    1 MATPIRPLSYSLRRQSNGESRRLSTRVTSVTVCSVRYSVLSF 42 
9634050    1 MVTPTRPLSPSLRKRSSGRFRQWSSRVTSGMVCLVRYSALCS 42 
30387502   1 MVTPIRPLSCSLRKLSNGESRRSSTRVTSVMVCSVRCSVLSF 42 
17570840   1 MVIPIRPLSPSLRKRSSGRFRQWSSRVTSGMVCLVRYSALCS 42 
194100411  1 MVTLIRPLSCSLRRLSSGESRRLSMRVTSVTVCLVRCSVLSF 42 
194100465  1 MGTKRSPLSSSLRKPNSGRFRLWSSRATSVTVCSVTCSSLCS 42 
189427247  1 MVTPTRPLSPSLRKRSSGRFRQWSSRVTSGMVCLVRYSALCS 42 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap