Conserved Protein Domain Family
PHA00380

?
PHA00380: PHA00380 
tail protein
Statistics
?
PSSM-Id: 133872
View PSSM: PHA00380
Aligned: 3 rows
Threshold Bit Score: 996.734
Threshold Setting Gi: 12248116
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
194186883   1 MAYVPLSGTNVRILADVPFSNDYKNTRWFTSSSNQYNWFNSKSRVYEMSKVTFMGFRENK---PYVSVSLPIDKLYSASY 77 
12248116    1 MPTLPTSGTDVVFMSGIPFTSDYKHTRWFGSKAEQTVYFGNQTVRHQEAEVVFTGSKENRanrSYVTIDVPYDDVYDVNY 80 
22855157    1 MAYVPLSGTDVRIFSNVPFSNDYKSTRWFTNADAQYSYFNAKPRVHVINECNFVGLKEGT---PHIRVNKRIDDLYNACY 77 
194186883  78 IMFQNADYGNKWFYAFVTELEFKNSAVTYVHFEIDVLQTWMFDIKFQESFIVREHVKLWNDDGTPTINTIDEGLSYGSEY 157
12248116   81 FMFNNKSYMNRWFYAFVTKIEYVNSSRTRMYFTIDVIQTWMFEIDFQPSYVKREHQTEYQSNGKPVVNTIPEKLDYGTDY 160
22855157   78 MIFRNTQYSNKWFYCFVTRLEYVNSGVTNLYFEIDVIQTWMFDFKFQPSYIVREHQEMWDANNEPLTNTIDEGLNYGTEY 157
194186883 158 DIVSVENHKPYDDMMFLVIISKSIMHGTPGEEEsrlnDINASLNGMPQPLCYYIHPFYKDGKVPKTYIGDNNANLS---- 233
12248116  161 DTIYEYHFNPFEGLQWLVIQAKQEIHTVEEGDQ----QISPSFIGAPQPLVTYLYPVNRNGTGRFPVVEVNHFERKfdpk 236
22855157  158 DVVAVEQYKPYGDLMFMVCISKSKMHAT-AGETfkagEIAANINGAPQPLSYYVHPFYEDGSSPKVTIGSNEVQVS---- 232
194186883 234 ------PIVNMLTNIFSQKSAVNDIVNMYVTDYIGLKLDYK--NGDKELKLDKDMFEQAGIADDKHGNVDTIFVKKIPDY 305
12248116  237 ktdfefPVEDVLKEIYKNESSVNNVVNIFLTENTGLPMSVSgtGGNMTVNFTDECFIQSRVIGDKLDPIPLLQLTFAPNF 316
22855157  233 ------KPTDFLKNMFTQEHAVNNIVSLYVTDYIGLNIHYD--ESAKTMSLRDTMFEHAQIADDKHPNVNTIYLKEVKEY 304
194186883 306 EALEIDTGDKWGGFTKDQESKLMMYPYCVTEITDFKGNHMNLKTEYINNsKLKIQVRGSLGVSNKVAYSVQDYNADSALs 385
12248116  317 HFLKKSLFDQYDVITKPTESKLLMYPYTILIMDDFKGNRVEYKLEYIDG-KVEVIAKGSVGVNNKTSYTIDNYNNLSEF- 394
22855157  305 EEKTIDTGYKFASFANNEQSKLLMYPYCVTTITDFKGNQIDIKNEYVNGsNLKIQVRGSLGVSNKVTYSVQDYNADTTLs 384
194186883 386 ggnrltASLDSSLINNNPNDIAILNDYLSAYLQGNKNSLENQKSSILFNGIMGMIGGGISAGAS----------AAGGSA 455
12248116  395 ------ASIEAGFINDSPNDIAIVNDYTSAYMQGNANSLRNRLDAAAFSGITNTIGSTLSAVGSlpsvdtatqgGGANLA 468
22855157  385 gdqnltASCNTSLINNNPNDVAIINDYLSAYLQGNKNSLENQKDSILFNGVMSMLGNGIGAVGS----------AATGSA 454
194186883 456 LGMASSVTGMTSTAGNAVLQMQAMQAKQADIANIPPQLTKMGGNTAFDYGNGYRGVYVIKKQLKAEYRRSLSSFFHKYGY 535
12248116  469 LGTAQSANNLVQTAGQSVFNIQGIDAQLKDINNMPPNLVKMGGNIAFSFGNLYSGVRFMIKQIKPEYYSKLKGFFKSYGY 548
22855157  455 VGVASSATGMVSSAGNAVLQIQGMQAKQADIANTPPQLVKMGGNTAYDYGNGYRGVYVIKKQIKEEYRNILSDFSRKYGY 534
194186883 536 KINRVKKPNLRTRKAFNYVQTKDCFISGDINNNDLQEIRTIFDNGITLWHTDNIGNYSVENELR 599
12248116  549 KSNRIKIPNLRTRTAFNYVETEGCNIKGNIPNEDLNDLKAIFDGGITLWHVNDVGNYNVTNGVR 612
22855157  535 KTNLVKMPNLRTRESYNYVQTKDCNIIGNLNNEDLQKIRTIFDSGITLWHADPVGDYTLNNEVR 598
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap