Conserved Protein Domain Family
III

?
PHA00370: III 
attachment protein
Statistics
?
PSSM-Id: 164795
View PSSM: PHA00370
Aligned: 4 rows
Threshold Bit Score: 306.073
Threshold Setting Gi: 9630752
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9625389    1 MKRKIIAISLFLyiplsnadnwesitkSYYTgfamsktveskdqdgktvrkevitqadlttacndakasaqdvfnqmklt 80 
9626239    1 MKRKIIAISLFLyiplsnadnwesitkSYYTgfaisktveskdkdgkpvrkevitqadlttacndakasaqnvfnqiklt 80 
9630752    1 MKKIIIAL-FFA---------------PFFT------------------------------------------------- 15 
17426224   1 MKKLLFAIPLVV---------------PFYS------------------------------------------------- 16 
9625389   81 fsgiwpdsqfrlvtgdtcvyngspsekteswsiraqvegdmqrsvpdeepSEQTPEEICEAKPPIDGVFNNVSKGDEG-G 159
9626239   81 lsgtwpnsqfrlvtgdtcvyngspgekteswsiraqvegdiqrsvpdeepSEQTPEEICEAKPPIDGVFNNVFKGDEG-G 159
9630752   16 --------------------------------------------------HATTDAE-CLSKPAFDGTLSNVWKEGDS-- 42 
17426224  17 --------------------------------------------------HSAETVESCLAKPHTENSFTNVWKDDKTlD 46 
9625389  160 FYINYNGCEYEATGVTVCQNDGTVCASSaWKPTGyvpesgesssSPVKDGDTGGTGEGGSDTGGDTGGG----------- 228
9626239  160 FYINYNGCEYEATGVTVCQNDGTVCSSSaWKPTGyvpesgepssSPLKDGDTGGTGEGGSDTGGDTGGG----------- 228
9630752   43 RYANFENCIYELSGIGIGYDNDTSCNGH-WTPVR----------AADGSGNGGDDNSSGGGSNGDSGNNstpdtvtpgqt 111
17426224  47 RYANYEGCLWNATGVVVCTGDETQCYGT-WVPIG----------LAIPENEGGGSEGGGSEGGGSEGGGtkppeygdtpi 115
9625389      --------------------------------------------------------------------------------    
9626239      --------------------------------------------------------------------------------    
9630752  112 vnlpsdlstlsipanvvksdsigsqfslytnasctmcsgyylsnnadsiaianitetvkadynqpdmwfeqtdsdgnhvk 191
17426224 116 pgytyinpldgtyppgteqnpanpnpsleesqplntfmfqnnrfrnrqgaltvy-------------------------- 169
9625389      --------------------------------------------------------------------------------    
9626239      --------------------------------------------------------------------------------    
9630752  192 ilqnsykavsynveskqsdvnnptyinysysvnvkqvsydtsnvcimnwetfqnkcdasravlitdtvtpsysrnitiqs 271
17426224 170 ------------------tgtvtqgtdpvktyyqytpvsskamydaywngkfrdcafhsgfnedpfvceyqgqssdlpqp 231
9625389  229 --DTGGGSTGGDTGGSTGGGSTGGGSTGGSTGKSLTKEDVTAAIHDaSPSIGDAVKDSLTEDNDQNDNQKKADEQSAKAS 306
9626239  229 --DTGGGSTGGDTGGSSGGGSSGGGSSGGSTGKSLTKEDVTAAIHVaSPSIGDAVKDSLTEDNDQYDNQKKADEQSAKAS 306
9630752  272 niNYQGSNGSGGSGGSGGSGNDGGGT---------GNNGNGTGDFD-YVKMANANKDALTESFDLSALQADTGASLDGSV 341
17426224 232 pvNAGGGSGGGSGGGSEGGGSEGGGSEGGGSEGGGSGGGSGSGDFD-YEKMANANKGAMTENADENALQSDAKGKLDSVA 310
9625389  307 ASVSDAISDGMRGVGNFVDDLGGESSQYGIGNSEMDlsvslakgQLGidlEGHGSAWESFLN--DGALRPSIPSGHGCTD 384
9626239  307 ASVSDAISDGMRGVGNFVDDFGGESSQYGTGNSEMDlsvslakgQLGidrEGHGSAWESFLN--DGALRPSIPTGHGCTN 384
9630752  342 QGTLDSLSGFSDSIGGLVGNGSAISGEFAGSSAAMN--------AIG---EGDKSPLLDSLSflKDGLFPALPEFKQCTP 410
17426224 311 TDYGAAIDGFIGDVSGL-ANGNGATGDFAGSNSQMA--------QVG---DGDNSPLMNNFR----QYLPSLPQSVECRP 374
9625389  385 FVMFQGSVYQLDIGCDKLGDIKSVLSWVMYCLTFWYVFQSATSLLRKGEQ 434
9626239  385 FVMYQGSVYQIEIGCDKLNDIKSVLSWVMYCLTFWYVFQSVTSLLRKGEQ 434
9630752  411 FVFAPGKEYEFIIECKYIDMFKGIFAFILYFWTFVTVYDSFSGILRKGRG 460
17426224 375 FVFSAGKPYEFSIDCDKINLFRGVFAFLLYVATFMYVFSTFANILRNKES 424
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap