Conserved Protein Domain Family
H

?
PHA00369: H 
minor spike protein
Statistics
?
PSSM-Id: 164794
View PSSM: PHA00369
Aligned: 7 rows
Threshold Bit Score: 465.6
Threshold Setting Gi: 89888653
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
89888618    1 MFGAIAGGIASSLAGG--------LINKAFGGGQSAS---STGVQGDVLASDNNVIGAN-DAGIKSAIQGSNPPNGQQAA 68 
9625365     1 MLGAVVGGIASALASG--------AASKLFGGSQRGVsvmQQGAESAGLTNGGGAISMDnDQGIQSAIQGSNVPPAGQLP 72 
89888653    1 MLGAVVGGIASALAGG--------AASKLFGGKPAA----QAATESSGLSNGQGVIGMDqDAGIQSAIQGSNVPNGQIPA 68 
9626348     1 MFGSIAGGIASALAGG--------LMGKLFGGGQSAD---STGIQGNVLASDNNVVGAN-DAGIKSAIQGSTVPNSQEAA 68 
9626383     1 MFGAIAGGIASALAGG--------AMSKLFGGGQKAA---SGGIQGDVLATDNNTVGMG-DAGIKSAIQGSNVPNPDEAA 68 
89888105    1 MFGAIAGGIASSLAGG--------LLNKAFGGGSSAP---QSGVQGNVLATDNNVIGAN-DAGIKSAIQGSNPPNGQQAA 68 
242346752   1 MLGSIIGGIGSSLLGGlasggissLLNKMFSKMP------EHAASSAGLTNGQGTIGMDtDAGIQSAIQGSNVPPAGQLP 74 
89888618   69 PNAISGVLAD-------TGKDALSSITGAGVNK----LMEKIGL-SKTAADKGKDTKDYLASAFPDLNPWERAGAGASSA 136
9625365    73 ESQNSGVMADagnmlrnAGKSLLDGTIQAGSDKvkqaLIDKLIG-GNDAKDRGKATRDYLAAAFPELNPWERAGAGASTA 151
89888653   69 PTQTGGVMSDaknmiknAGKDLLDGVMTAGSDRikqaLVDKLS--GNDAKKQGQATRDYLAAAFPELNAWERAGAGASGA 146
9626348    69 PSAISGILAD-------SGKHALSSLTNAGANK----LMEAVGL-SKSASDKGKDTKDYLAAAFPELNPWERAGAGASSP 136
9626383    69 PSFVSGAMAK-------AGKGLLEGTLQAGTSAvsdkLLDLVGLgGKSAADKGKDTRDYLAAAFPELNAWERAGADASSA 141
89888105   69 PNAISGVLAD-------TGKDALSSITGAGVNK----LMEKIGL-SKDAAAKGKDTKDYLASAFPELNPWERAGAGASSA 136
242346752  75 ASNTSGVMADagnmirnAGRALLDGTIQAGSDKvkeaLIDKLVG-GNDAKDRGKATRDYLAAAFPELNPWERAGADASTA 153
89888618  137 GMVDAGFQNQKELTRMQLDNQKEIAKMQNDTQKDIAGIQSVTSRQNTKDAVYAQNEMLEYNQKESMSRVGSILENTSLTK 216
9625365   152 GLESSAQNQQKEMLKMQLDNQKDIAKMQMDNNLQIAGIQSATSRQNTKDSVYAQNEMLQYNQRESQARVASILANTDLTT 231
89888653  147 GLESSGQNQQKELMRMQLDTQKDIAKMQMHNNLQIAGIQSATSRENTKDSVYAQNEMLKFNQQESQARVESILANTDLTA 226
9626348   137 GMQDAGFQNQKELTKMQLDNQKEIAKMQNETQKEIAGLQSITSRENTKDTVYAQNEMLAYNQKESMSRVGAILENTSLTK 216
9626383   142 GMVDAGFENQKELTKMQLDNQKEIAEMQNETQKEIAGIQSATSRQNTKDQVYAQNEMLAYQQKESTARVASIMENTNLSK 221
89888105  137 GMVDAGFQNQKELTRMQLDNQKEIAKMQNDTQKDIAGIQSVTSRQNTKDSVYAQNEMLQYNQKESMSRVGAILENTSLTK 216
242346752 154 GLESSAQNQQKEMLKMQLDNQKDIAKMQMNNNLQIAGIQSATSRQNTKDSVYAQNEMLQYNQRESQARVASILANTDLTT 233
89888618  217 QQQTSEIMRQMLTQAQTAGQHFTNDQIKELTRKVGADIDSVRantdrthvetqrskQEVQNSRYASSQVGKTAKDVSNAV 296
9625365   232 KQATHEIMRMALTRAQETGQHLTNSQIMALEKKVYAEIGKIH--------------QDTQNSRYGSSQVTAAAKDVTNMI 297
89888653  227 KQAAHEIMRMALTRAQETGQHLTNSQIMALEKKVYAEIGKIH--------------QDTQNARYGSSQVTAAAKDVTNMI 292
9626348   217 QQQTSEIMRQMLTQAQTAGQYFTNDQIKELTRKVGADIDAVRantarthvetdrskQEVQNSRYASSQVGKTAKDVSNAI 296
9626383   222 QQQVSEIMRQMLTQAQTAGQYFTNDQIKEMTRKVSAEVDLVH--------------QQTQNQRYGSSHIGATAKDISNVV 287
89888105  217 QQQTSEIMRQMLTQAQTSGQHFTNDQIQELTRKVGADIDAVRanterthvetdrskQEVQNSRYASSQVGKTAKDVSNVI 296
242346752 234 KQATHEIMRMALTRAQETGQHLTNSQIMALEKKVYAEIGKIH--------------QDTQNSRYGSSQVTAAAKDVTNMI 299
89888618  297 TDTASSIVDYfrgidnkVADAYNNYFKDGKSDGIGSNIK 335
9625365   298 TDAASGASDW-------VSQQWNSFFKDGKSNGISLNTR 329
89888653  293 TDATSGAADW-------VSQQWNSFFKDGKSNGIPLNTR 324
9626348   297 TDTAGSIVDYfrgadqkVADVYNNYFKDGKSKGIESNHR 335
9626383   288 TDAASGVVDIfhgidkaVADTWNNFWKDGKADGIGSNLS 326
89888105  297 SDASSGIVDYfrgvdkaVADTWNNYFKDGKSDGISSNHR 335
242346752 300 TDASSGFADW-------ASQQWNSFFKDGKSDGIPLNTR 331
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap