Conserved Protein Domain Family
II

?
PHA00360: II 
replication initiation protein
Statistics
?
PSSM-Id: 177271
View PSSM: PHA00360
Aligned: 2 rows
Threshold Bit Score: 840.846
Threshold Setting Gi: 17426218
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9626233    1 MIDMLVLRIPFKSSLVSERLdSKGNYVSHVNLAEVARLSGLTLAAHTVEYAIDGDLTVSGLKHPYESLPSHYAGIALKIF 80 
17426218   1 MIDMLVLRLPFIDSLVCSRL-SGNDLIAFVDLSKIATLSGMNLSARTVEYHIDGDLTVSGLSHPFESLPTHYSGIAFKIY 79 
9626233   81 EGGKNFEPCVELKASPAKLLQGHNVFGPTSFELCGLEFFGAFAAAMPELYDLCDVTNTVVGRIDVTFSAKVANDHIANQV 160
17426218  80 EGSKNFYPCVEIKASPAKVLQGHNVFGTTDLALCSEALLLNFANSLPCLYDLLDVNATTISRIDATFSARAPNENIAKQV 159
9626233  161 ISFLRNVSNGQTKKTRALDYETTVMWNEGSRHRTLVAYLKHHEVQAQIKRLQKKKSSHLTIYEKNCLEVLSNPDLQLYAV 240
17426218 160 IDHLRNVSNGQTKSTRSQNWESTVTWNETSRHRTLVAYLKHVELQHQIQQLSSKPSAKMTSYQKEQLKVLSNPDLLEFAS 239
9626233  241 GLVRFEARLHTRFFENFGLPRKFFDIVKYQDNYESGSFNLICDLWKKSFKDLFDAFKGSDMNVYDDSKVYDALINNFSSV 320
17426218 240 GLVRFEARIKTRYLKSFGLPLNLFDAIRFASDYNSQGKDLIFDLWSFSFSELFKAFEGDSMNIYDDSAVLDAIQSKHFTI 319
9626233  321 TKSGNISNSKANRLFGFYRRLVNEGYDNVAQTMERTTFWRSLKELTSVGLSKAQLMNLSTDNNVVPLVQMINVDFSQQYP 400
17426218 320 TPSGKTSFAKASRYFGFYRRLVNEGYDSVALTMPRNSFWRYVSALVECGIPKSQLMNLSTCNNVVPLVRFINVDFSSQRP 399
9626233  401 EWYVEPVsifnrsnvvsINAA 421
17426218 400 DWYNEPV----------LKIA 410
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap