Conserved Protein Domain Family
PHA00212

?
PHA00212: PHA00212 
putative transcription regulator
Statistics
?
PSSM-Id: 164787
View PSSM: PHA00212
Aligned: 3 rows
Threshold Bit Score: 94.4255
Threshold Setting Gi: 13095809
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
45597388  1 MEVLMEQVVTHYGETIQQHSVEWYKKQLLKDFSVQFIKDSLLPQLFEWSNAYKAAVELTNKKP 63 
14251160  1 MEVLMEQVVTHYGETIQEHSVEWYKKQLLKDFSVQFIKDSLLPQLFEWSNAYKAAVELTNKKP 63 
13095809  1 ----MEQVVTHYGEAIQQHSVEWYKKQLLKDLSVQFIKDSLLPQLFEWSNAYKAAVELTK--- 56 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap