Conserved Protein Domain Family
PHA00202

?
PHA00202: PHA00202 
DNA replication initiation protein
Statistics
?
PSSM-Id: 164786
View PSSM: PHA00202
Aligned: 8 rows
Threshold Bit Score: 677.859
Threshold Setting Gi: 49248537
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9635486     6 SPTRPLNNVSTWGCLMTTATNILKSFDEQSVHIDYLCFTFAVKDLRHCHDAVRRLHKHEEYKGFAKSGLLQRHCrapkfp 85 
49248537    6 SPTRPLNNVSIWGCSMTTATNILKSFDEQSVHIDYLCFTFAVKDLRHCHDAVRRLHKHEEYKGFAKSGLLQRHCrapkfp 85 
52221122    1 -----------------MPCKHPHHDTVRPVKVDHLAFTFAYADLRHLDKSNDQDFINLQMPVYHEPKTKTKEQ------ 57 
30039744    1 MIRFALSKLTTWLLLSPMRTCATWTKATTKTLSIYRCPFITSQRPEPRNKARCALPWNKSSIIWKRTETKCPRC------ 74 
9635477     6 SPTRPLNNVSTWGCLMTTATNILKSFDEQSVHIDYLCFTFAVKDLRHCHDAVRRLHKHEEYKGFAKSGLLQRHCrapkfp 85 
49248528    6 SPTRPLNNVSIWGCSMTTATNILKSFDEQSVHIDYLCFTFAVKDLRHCHDAVRRLHKHEEYKGFAKSGLLQRHCrapkfp 85 
18071302    1 -----------------MPCNHPHHDTVRPVKVDHLAFTFAYADLRHLDKSNDQDFINLQMPVYHEPKTRTKEQ------ 57 
238821373   1 MIRFALSKLTTWLLLSPMRICATWTKATTKTLSIYRCPFTTSQKLKPRNKARFALPWNKSSIIWKRTKTKCQRC------ 74 
9635486    86 appVFNPTVAQTSDEIDAYNKAFDICYRNYLEDCLRIFTNQVLGLSLSAPRGLGFQFYTESMKLTSPDGEDFCGFVGIGG 165
49248537   86 appVFNPTVAQTSDEIDAYNKAFDICYRNYLEDCLRIFTNQVLGLSLSAPRGLGFQFYTESMKLTSPDGEDFCGFVGIGG 165
52221122   58 ------GAVCSTLEQIERHMEAHKNKVSKMLFHRFDLFMSKIMGFRLSPMRGRGLHGYNDSMVILDMTGQVECGLVGIGG 131
30039744   75 ---SFIALICSCPKSW----------------------------LSLSPMRGRGLHGYNDSMVILDMTGQVECGLVGIGG 123
9635477    86 appVFNPTVAQTSDEIDAYNKAFDICYRNYLEDCLRIFTNQVLGLSLSAPRGLGFQFYTESMKLTSPDGEDFCGFVGIGG 165
49248528   86 appVFNPTVAQTSDEIDAYNKAFDICYRNYLEDCLRIFTNQVLGLSLSAPRGLGFQFYTESMKLTSPDGEDFCGFVGIGG 165
18071302   58 ------GAVCSTLEQIEHHMEAHRNKVSKMLFHRFDLFMSKIMGFRLSPMRGRGLHGYNDSMVISIMTGQVECGLVGIGG 131
238821373  75 ---FFIASICSCPKSW----------------------------LSLSPMRGRGLHGYNDSMVILDMTGQVECGLVGIGG 123
9635486   166 NNDTVHFQINGTGCKHVFARRPTWSLHDWLT--NVLGVQTLARVDLAYDDYDGIFDCEYAYKAWRDDCFRTAERGRGPVL 243
49248537  166 NNDTVHFQINGTGCKHVFARRPTWSLHDWLT--NVLGVQTLARVDLAYDDYDGIFDCEYAYKAWRDDCFRTAERGRGPVL 243
52221122  132 NNDTVFVQINGTGCTKLFDRIDSKKLHWWLA--QVLGITRLVRLDLAVDDYTGNFDAKYAEKCFYEGAFRTAPRGQGPSM 209
30039744  124 NNDTVFVQINGTGCTKLFDRIDSKKLHWWLA--QVLGITRLVRLDLAVDDYTGNFDAKYAEKCFYEGAFRTAPRGQGPSM 201
9635477   166 NNDTVHFQINGTGCKHVFARRPTWSLHDWLT--NVLGVQTLARVDLAYDDYDGIFDCEYAYKAWRDDCFRTAERGRGPVL 243
49248528  166 NNDTVHFQINGTGCKHVFARRPTWSLHDWLT--NVLGVQTLARVDLAYDDYDGIFDCEYAYKAWRDDCFRTAERGRGPVL 243
18071302  132 NNDTAFCPNQRHGV-HPNTFRPYRTLRSFIGarSGLGITRLVRLDLAVDDYTGNFDAKYAEKCFYEGAFRTAPRGQGPSM 210
238821373 124 NNDTVFVQINGTGCTKLFDRIDSKNLHWWLA--QVLGITRLVRLDLAVDDYTGNFDAKYAEKCFYEGAFRTAPRGQGPSM 201
9635486   244 HEDMTIASIGkdgkpIYTKEQYSIGSRTSRIYWRIYNKALEQKLANTGLVWYRSEVELKKWNVDVLLNPAGAYAALNDFA 323
49248537  244 HEDMTIASIGkdgkpIYTKEQYSIGSRTSRIYWRIYNKALEQKLANTGLVWYRSEVELKKWNVDVLLNPAGAYAALNDFA 323
52221122  210 VPHKRITENG-----ALMEEATIVGSRSSAIYWRIYNKKLEQKITDPDLIWYRNEVELKKCDIELLANPAASFAGICPFA 284
30039744  202 VPHKRITENG-----ALMEEATIVGSRSSAIYWRIYNKKLEQKITDPDLIWYRNEVELKKCDIELLANPAASFAGICPFA 276
9635477   244 HEDMTIASIGkdgkpIYTKEQYSIGSRTSRIYWRIYNKALEQKLANTGLVWYRSEVELKKWNVDVLLNPAGAYAALNDFA 323
49248528  244 HEDMTIASIGkdgkpIYTKEQYSIGSRTSRIYWRIYNKALEQKLANTGLVWYRSEVELKKWNVDVLLNPAGAYAALNDFA 323
18071302  211 VPHKRITGPG-----ALMEEATIVGSRSSAIYWRIYNKKLEQKITDPDLIWYRNEVELKKCDIELLANPAASFAGICPFR 285
238821373 202 VPHKRITENG-----ALMEEATIVGSRSSAIYWRIYNKKLEQKITDPDLIWYRNEVELKKCDIELLANPAASFAGICPFA 276
9635486   324 ASISTAKKFNTKPvPTKRAALDLLASAHWMRRQYGKILNSLIEFHEGDIETVVGSLVRDGTK------FTFPDTYGKLVT 397
49248537  324 ASISTAKKFNTKPvPTKRAALDLLASAHWMRRQYGKILNSLIEFHEGDIETVVGSLVRDGTK------FTFPDTYGKLVT 397
52221122  285 ASIECTPPVKFSR-NKKAQGLEFMARIAWVRRQCGVALAEVIAMTQGDLGEAFGMLIPHKHRrpdfelLGVPDSYTQLKN 363
30039744  277 ASIECTPPVKFSR-NKKAQGLEFMARIAWVRRQCGVALAEVIAMTQGDLGEAFGMLIPHKHRrpdfelLGVPDSYTQLKN 355
9635477   324 ASISTAKKFNTKPvPTKRAALDLLASAHWMRRQYGKILNSLIEFHEGDIETVVGSLVRDGTK------FTFPDTYGKLVT 397
49248528  324 ASISTAKKFNTKPvPTKRAALDLLASAHWMRRQYGKILNSLIEFHEGDIETVVGSLVRDGTK------FTFPDTYGKLVT 397
18071302  286 PSIECTPPVKFSR-NKKAQGLEFMARIAWVRRQCGVALAEVIAMTQGDLGEAFGMLIPHKHRrpdfelLGVPDSYAQLKN 364
238821373 277 ASIECTPPVKFSR-NKKAQGLEFMARIAWVRRQCGVALAEVIAMTQGDLGEAFGMLIPHKHRrpdfelLGVPDSYTQLKN 355
9635486   398 HILET 402
49248537  398 HILET 402
52221122  364 TLWS- 367
30039744  356 TLWS- 359
9635477   398 HILET 402
49248528  398 HILET 402
18071302  365 TLWS- 368
238821373 356 TILEL 360
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap