Conserved Protein Domain Family
PHA00201

?
PHA00201: PHA00201 
major capsid protein
Statistics
?
PSSM-Id: 177268
View PSSM: PHA00201
Aligned: 22 rows
Threshold Bit Score: 598.366
Threshold Setting Gi: 281416197
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
119637776   1 MANMNGGQQMGKDQGKG-MSAGDKLALFLKVFGGEVLTAFTRTSVTMNKHLVRSIQSGKSAQFPVLGRTKAAYLQPGENL 79 
29366729    1 MANATGGQQIGANQGKG-QSAADKLALFLKVFGGEVLTAFVRRSVTMDKHMVRTIQNGKSASFPVMGRTKGYYLAPGENL 79 
77118198    1 MANVP-GQKIGTDQGKG-KSSSDALALFLKVFAGEVLTAFTRRSVTADKHIVRTIQNGKSAQFPVMGRTSGVYLAPGERL 78 
30387487    1 MANMTGGQQLGTNQGKDvMAAGDKLALFLKVFGGEVLTAFARTSVTTSRHMVRSISSGKSAQFPVLGRTQAAYLAPGENL 80 
194100342   1 MANVP-GQKIGTDQGKG-KSSSDALALFLKVFAGEVLTAFTRRSVTADKHIVRTIQNGKSAQFPVMGRTSGVYLAPGERL 78 
194100288   1 MANINGGQQMGKDQGKG-MSAGDKLALFLKVFGGEVLTAFTRTSVTMNKHLVRSIQSGKSAQFPVLGRTKAAYLQPGENL 79 
194100498   1 MANMNGGQQMGKDQGKG-MSAGDKLALFLKVFGGEVLTAFTRTSVTMNKHLVRSIQSGKSAQFPVLGRTKAAYLQPGENL 79 
30387488    1 MANMTGGQQLGTNQGKDvMAAGDKLALFLKVFGGEVLTAFARTSVTTSRHMVRSISSGKSAQFPVLGRTQAAYLAPGENL 80 
212671413   1 MANINGGQQMGKDQGKG-MSAGDKLALFLKVFGGEVLTAFTRTSVTMNKHLVRSIQSGKSAQFPVLGRTKAAYLQPGENL 79 
212671429   1 MANINGGQQMGKDQGKG-MSAGDKLALFLKVFGGEVLTAFTRTSVTMNKHLVRSIQSGKSAQFPVLGRTKAAYLQPGENL 79 
119637776  80 DDKRKDMKHTEKTINIDGLLTADVLIYDIEDAMNHYDVRSEYTAQLGESLAMAADGAVLAEMAKLCNLPTANNENIAGLG 159
29366729   80 DDKRKDIKHSEKVIQIDGLLTSDVLIYDIEDAMNHYDVRAEYSAQLGEALAIAADGAVLAEMAKLCNLPAASNENIAGLG 159
77118198   79 SDKRKGIKHTEKVITIDGLLTADVMIFDIEDAMNHYDVAGEYSNQLGEALAIAADGAVLAEMAILCNLPAASNENIAGLG 158
30387487   81 DDIRKDIKHTEKVITIDGLLTADVLIYDIEDAMNHYDVRSEYTSQLGESLAMAADGAVLAEIAGLCNVESQYNENITGLG 160
194100342  79 SDKRKGIKHTEKVITIDGLLTADVMIFDIEDAMNHYDVAGEYSNQLGEALAIAADGAVLAEMAILCNLPVASNENIAGLG 158
194100288  80 DDKRKDMKHTEKTINIDGLLTADVLIYDIEDAMNHYDVRSEYTAQLGESLAMAADGAVLAEMAKLCNLPSASDENIAGLG 159
194100498  80 DDKRKDMKHTEKTINIDGLLTADVLIYDIEDAMNHYDVRSEYTAQLGESLAMAADGAVLAEMAKLCNLPTANNENIAGLG 159
30387488   81 DDIRKDIKHTEKVITIDGLLTADVLIYDIEDAMNHYDVRSEYTSQLGESLAMAADGAVLAEIAGLCNVESQYNENITGLG 160
212671413  80 DDKRKDMKHTEKTINIDGLLTADVLIYDIEDAMNHYDVRSEYTAQLGESLAMAADGAVLAEMAKLCNLPSAKDENIAGLG 159
212671429  80 DDKRKDMKHTEKTINIDGLLTADVLIYDIEDAMNHYDVRSEYTAQLGESLAMAADGAVLAEMAKLCNLPSAKDENIAGLG 159
119637776 160 KAHVLEV-GDQATLQgDQVKLGQAIIAQLTLARAKLTGNYVPSSDRVFYTTPDNYSAILAALMPNAANYQALIDPSTGSI 238
29366729  160 QAVVLNI-GAAADLV-DVEARGKAILKGLTLARARLTKNYVPAGDRRFYCAPEDYSAILSALMPNAANYAALIDPETGNI 237
77118198  159 TASVLEV-GKKADLD-TPAKLGEAIIGQLTIARAKLTSNYVPAGDRYFYTTPDNYSAILAALMPNAANYAALIDPETGNI 236
30387487  161 TATVIETtQDKTTLT-DQVALGKEIIAALTKARAALTKNYVPSSDRVFYCDPDSYSAILAALMPNAANYAALIDPEKGSI 239
194100342 159 TASVLEV-GKKADLD-TPAKLGEAIIGQLTIARAKLTSNYVPAGDRYFYTTPDNYSAILAALMPNAANYAALIDPETGNI 236
194100288 160 KAHVLEV-GEQSALKgDQVKLGQAIIAQLTLARAKLTSNYVPSSDRVFYTTPDNYSAILAALMPNAANYQALIDPSTGSI 238
194100498 160 KAHVLEV-GDQATLQgDQVKLGQAIIAQLTLARAKLTGNYVPSSDRVFYTTPDNYSAILAALMPNAANYQALIDPSTGSI 238
30387488  161 TATVIETtQDKTTLT-DQVALGKEIIAALTKARAALTKNYVPSSDRVFYCDPDSYSAILAALMPNAANYAALIDPEKGSI 239
212671413 160 KAHVLEV-GKQSDLRgDQVKLGQAIIAQLTLARAKLTSNYVPSADRVFYTTPDNYSAILAALMPNAANYQALIDPSTGSI 238
212671429 160 KAHVLEV-GKQSDLRgDQVKLGQAIIAQLTLARAKLTSNYVPSADRVFYTTPDNYSAILAALMPNAANYQALIDPSTGSI 238
119637776 239 RNVMGFEVIEVPHLTAGGAGDNRAEEgv-aPTNQKHAFPDTASGDTRVALDNVVGLFNHRSAVGTVKLKDMALERARRAN 317
29366729  238 RNVMGFEVIEVPHLTVGGAGDNNPADgv-aPTNQKHIFPATATGDDRVAQNNVVGLFNHRSAVGTVKLKDMALERARRPE 316
77118198  237 RNVMGFVVVEVPHLVQGGAGETRGDDgitiASGQKHAFPATASSDVKVTMDNVVGLFSHRSAVGTVKLRDLALERDRDVD 316
30387487  240 RNVMGFEVVEVPHLTAGGAGTSREG-----TTGQKHAFPATKSGNDKVAKDNVIGLFMHRSAVGTVKLRDLALERARRAN 314
194100342 237 RNVMGFVVVEVPHLVQGGAGETRGEDgitiASGQKHAFPATATGDVKVAMDNVVGLFSHRSAVGTVKLRDLALERDRDVD 316
194100288 239 RNVMGFEVIEVPHLTAGGAGEDRTEEgv-nPTGQKHAFPETSSGDTRVALDNVVGLFNHRSAVGTVKLKDMALERARRAN 317
194100498 239 RNVMGFEVIEVPHLTAGGAGDNRAEEgv-aPTNQKHAFPDTASGDTRVALDNVVGLFNHRSAVGTVKLKDMALERARRAN 317
30387488  240 RNVMGFEVVEVPHLTAGGAGTSREG-----TTGQKHAFPATKSGNDKVAKDNVIGLFMHRSAVGTVKLRDLALERARRAN 314
212671413 239 RNVMGFEVIEVPHLTAGGAGEDRPEEgv-nPTGQKHAFPETSSGDTRVALDNVVGLFNHRSAVGTVKLKDMALERARRAN 317
212671429 239 RNVMGFEVIEVPHLTAGGAGEDRPEEgv-nPTGQKHAFPETSSGDTRVALDNVVGLFNHRSAVGTVKLKDMALERARRAN 317
119637776 318 FQADQIIAKYAMGHGGLRPEACGALVFKKA 347
29366729  317 FQADQIIGKYAMGHGGLRPEAAGALVFTPA 346
77118198  317 AQGDLIVGKYAMGHGGLRPEAAGALVFSPA 346
30387487  315 FQADQIIAKYAMGHGGLRPEAAGAVVFKTK 344
194100342 317 AQGDLIVGKYAMGHGGLRPEAAGALVFSPA 346
194100288 318 FQADQIIAKYAMGHGGLRPEACGALVLKKS 347
194100498 318 FQADQIIAKYAMGHGGLRPEACGALVFKKT 347
30387488  315 FQADQIIAKYAMGHGGLRPEAAGAVVFQDE 344
212671413 318 FQADQIIAKYAMGHGGLRPEACGALVFNKA 347
212671429 318 FQADQIIAKYAMGHGGLRPEACGALVFQQG 347
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap