Conserved Protein Domain Family
PHA00159

?
PHA00159: PHA00159 
endonuclease I
Statistics
?
PSSM-Id: 177267
View PSSM: PHA00159
Aligned: 21 rows
Threshold Bit Score: 176.517
Threshold Setting Gi: 61806416
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
17570803    2 AGAYAARCTQGR-AFRSGLEDKVSKQLESKGIKFDYELWRIPYVIPESDHLYTPDFLLPNGIFIETKGLWDSDDRKKHLL 80 
9964626     3 NSKSSTRKRALKaGYRSGLEEQTAKDLKKRKVLFTYEETKIKWL-DSKVRTYTPDFVLPNGVIIETKGRFVAADRRKHLE 81 
68299736    2 AAKSWFRKSAGAvAYRSGLEDNIAKQLEAKGLPVSFESHFLNYIKPQTSHKYTPDFILPNGIIIESKGLFDVEDRKKHLL 81 
77118181    1 MAQWSAKRGHSVgAYRSGLEAKNQQWLEQNGVKAEYESHYINYVIPASDHKYTPDFILPNGIIVETKGIFAVEDRKKHLM 80 
148724465   1 -----------MpAFRSGLEDRFSKFLDKQGVAYLFEAEKFSYV---TESKYTPDFFLQSGVIIECKGFFKPSDRRKMLA 66 
119637758   1 MAGYGAKGIKKVgIYRSGLEEKNMKLLESKGVKAEYEMWRVPYVVPASNHHYTPDILLPNGIFVETKGLWESDDRKKHLL 80 
29366712    1 -MAYAGPKGARTgAFRSGLEDRNAKHMDKLGVKYDFERFHINYVVPARDAKYTPDFVLANGIIIETKGIWEVDDRKKHLL 79 
194100480   1 MAGYGAKGIKKVcIYRSGLEEKNMKLLESKGVKAEYEMWRVPYVVPASNHHYTPDILLPNGIFVETKGLWESDDRKKHLL 80 
194100324   1 MAQWSAKRGHSVgAYRSGLEAKNQQWLEQNGVKAEYESHYINYVIPASDHKYTPDFILPNGIIVETKGIFDSDDRKKHLL 80 
281416292   1 MAGYGAKGIRKVgAFRSGLEDKVSKQLESKGVTFDYELWRIPYVIPASDHLYTPDFLLPNGIFVETKGLWEAEDRKKHLL 80 
17570803   81 IREQHPEL-DIRLVFSSSRSKLYKGSPTSYGEWCEKHGILFAD-KLIPVAGVKEPKKEVPFDKFKTKKGV 148
9964626    82 IQKQFGTLyDIRFVFTNSKAKLYKGAKSSYADWCNKHGFLYAD-KTIPEDWLNE---------------- 134
68299736   82 IKEQYPDL-EIRFVFSRSATKLYKGSKTTYADWCIKYGFKFAD-KLIPVEWLREKSIIIPEGVLHAKKGD 149
77118181   81 VREQHPEL-DIRFVFSSSRSKLYKGSPTTYGAWCEKNGFKYAD-KFIPVEWLRETTVRLPSGILIPKKGV 148
148724465  67 VKAQHPEL-DIRFVFQRNNT-LSKQSKTTYGAWADKHGFPWCIyPDIPESWLKP---------------- 118
119637758  81 IREQYPDL-DIRLVFSSSRTKIYKGSPTSYAEFCEKHGILFAD-KLIPVAWLKEASRPVPFDKLKTKKEK 148
29366712   80 IREQYPDL-DIRLVFSNSNSKIYKGSPTSYADFCTKHGIQFAD-KLVPRDWLKEARKEIPQGVLVPKKGG 147
194100480  81 IREQYPDL-DIRLVFSSSRTKIYKGSPTSYAEFCEKHGILFAD-KLIPVAWLKEASRPVPFDKLKTKKHN 148
194100324  81 VREQYPEL-DIRFVFSSSRSKLYKGSPTTYGAWCEKNGYKYAD-KFIPVEWLREATVRLPSGILIPKKKG 148
281416292  81 IREQHPEL-DIRLVFSSSRTKIYKGSPTSYAEWCEKHNILFAD-KLIPVDWLKEPKRDVPFGKFKQKKGA 148
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap